KEGG   Vibrio splendidus: VS_3053Help
Entry
VS_3053           CDS       T00812                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vsp  Vibrio splendidus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VS_3053 (hemD)
Enzymes [BR:vsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VS_3053 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3200861..3201589
Genome map
AA seq 242 aa AA seqDB search
MTVLVTRPGSEGQSLCQQLADEGIQAIHHPLIRIVDNPHSSDLSTQLNNSDIIIAVSHHA
VTAAQNILSKTSSIWPTSPLYLGVGQKTAHVLSKVSKQKVNYPKVSDSEHLLKLTELNGV
DNKSILILRGNGGRELIRDSLLNRGAQVSYCETYRREYIPINDHNIYQTWINKKTSKVVI
TSQEQLEYLCSITPDEYLAWLSTRQLFVPSQRIVERAQQLGFSNVTNTQSATNQILLAAL
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgttggtgactcgtcccggttcagagggacaatcgctttgccaacaactagcg
gatgaagggattcaagcaatccatcatccgcttattcgtatcgttgataatccacactca
tcggatttaagcacccagcttaataacagcgatatcattattgcagtcagtcaccacgcc
gtgaccgctgcccaaaacatcctttcgaaaacttcatctatttggccaacttcgccgctt
tatcttggcgttggtcaaaaaactgcgcacgttttaagcaaagttagtaaacaaaaagta
aactatcccaaagtgagtgatagtgaacatcttctcaaacttactgaacttaatggcgta
gataataaatccattttgatactgcgtggaaatggtgggcgtgagctcattcgagattct
ttactcaatcgaggtgcacaagtctcttattgtgagacctaccgtagagaatatattccc
attaacgatcacaatatctatcaaacatggataaacaaaaaaacgtccaaagttgtcatc
actagtcaggaacaattggagtatctctgctcaattacccctgatgagtatttggcttgg
ctttcaacgagacaactatttgtcccaagccagcgcatagtagaacgagcacaacaactc
ggtttctcgaacgtgaccaatactcaaagtgctacgaaccaaatattactggctgctctc
cagccctag

DBGET integrated database retrieval system