KEGG   Vibrio tasmaniensis: VS_3053Help
Entry
VS_3053           CDS       T00812                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00860  Porphyrin and chlorophyll metabolism
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01120  Microbial metabolism in diverse environments
Module
vsp_M00121  Heme biosynthesis, glutamate => heme
vsp_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VS_3053
Enzymes [BR:vsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VS_3053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 PTH2
Motif
Other DBs
NCBI-ProteinID: CAV20331
UniProt: B7VME0
Position
1:3200861..3201589
Genome map
AA seq 242 aa AA seqDB search
MTVLVTRPGSEGQSLCQQLADEGIQAIHHPLIRIVDNPHSSDLSTQLNNSDIIIAVSHHA
VTAAQNILSKTSSIWPTSPLYLGVGQKTAHVLSKVSKQKVNYPKVSDSEHLLKLTELNGV
DNKSILILRGNGGRELIRDSLLNRGAQVSYCETYRREYIPINDHNIYQTWINKKTSKVVI
TSQEQLEYLCSITPDEYLAWLSTRQLFVPSQRIVERAQQLGFSNVTNTQSATNQILLAAL
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgttggtgactcgtcccggttcagagggacaatcgctttgccaacaactagcg
gatgaagggattcaagcaatccatcatccgcttattcgtatcgttgataatccacactca
tcggatttaagcacccagcttaataacagcgatatcattattgcagtcagtcaccacgcc
gtgaccgctgcccaaaacatcctttcgaaaacttcatctatttggccaacttcgccgctt
tatcttggcgttggtcaaaaaactgcgcacgttttaagcaaagttagtaaacaaaaagta
aactatcccaaagtgagtgatagtgaacatcttctcaaacttactgaacttaatggcgta
gataataaatccattttgatactgcgtggaaatggtgggcgtgagctcattcgagattct
ttactcaatcgaggtgcacaagtctcttattgtgagacctaccgtagagaatatattccc
attaacgatcacaatatctatcaaacatggataaacaaaaaaacgtccaaagttgtcatc
actagtcaggaacaattggagtatctctgctcaattacccctgatgagtatttggcttgg
ctttcaacgagacaactatttgtcccaagccagcgcatagtagaacgagcacaacaactc
ggtttctcgaacgtgaccaatactcaaagtgctacgaaccaaatattactggctgctctc
cagccctag

DBGET integrated database retrieval system