KEGG   Vibrio splendidus: VS_II0041Help
Entry
VS_II0041         CDS       T00812                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vsp  Vibrio splendidus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VS_II0041
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VS_II0041
Enzymes [BR:vsp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VS_II0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:49412..51862
Genome map
AA seq 816 aa AA seqDB search
MKKTILSLLISGSVVSPMALAMAPNTDLNLMPYPQTVELQTGQVKVDGNFKVYIKGFNSD
RVEYTAKRFIDRLERQTGVPILNWQVDSADQANLIIDIDAAPKSEVQNIDSVESYKITTQ
GEQITLSSPSPYGTIHGIETLLQLVETTATGYHIPAVTIVDEPRFRWRGVSYDTSRHFIE
FDVLIRQLDAMASAKMNVFHWHFWDDQGIRIQTESWPRLWSETADGNYYTKDQVRYLVEY
ARNLGIRVIPEVSLPGHSSAVAHAYPRLMSGGEGQNYEQERGWGVFEPLMDPLNPEVYEM
LGDVFDEVTELFPDEYFHIGGDEPNYAQWKNSEKHQQFIEENNIDGERGLQSYLNVKVEK
MLEERGKKMTGWDEIWHKDLPTSIVIQSWQGHDSIGRAAKEGYPGILSTGYYLDQPQPTS
YHYRNDPMPTGITVDDKLHSGEKFVTYQWQKPRSKGGPRKGTLTIIEGKDGTFRAFSDYN
GKSREEIYILDYVPGKTFVGHFDNFMSYTEFNLNLNPKGFTEGSYQLVGNVRWPTTGEVI
ASSDVEGSVIPEPNGGYPAELTDKEKELILGGEITMWLENKDSLTVENYLWPRSYAIAER
FWSDAELTDERSMYKRMKAMDTWSEVSVGLRHHADADMLLKRIAKGQDIHDLRVLAKYTE
PAQYYARNWEKWNSTEPKGTLYSQYERLNRFVDALPVESYAVYEMQDLVSEVATGNQQAL
EQLAQHYQQAKAAALAAKTVFAGNVSSVETVVVAEKTAEVADLALTLIAKAQAGEKVRAS
DANAYQAILFESAKIYDESIIAIVRPTELLLKQLAE
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaactatattatccctattgatttcaggttcagtagtgtccccaatggcgtta
gcaatggctccaaataccgatctaaatttaatgccgtacccacaaacggtcgagctgcaa
actgggcaagttaaggtcgacggtaacttcaaggtttacattaaaggctttaactctgat
cgcgttgaatacacggcgaaacgctttattgatcgccttgagcgtcagacgggtgtaccg
atcctaaattggcaggtggatagtgcagaccaagcgaacctgatcattgatatcgacgcg
gcgccaaagtctgaagtacagaacatcgactctgtcgagtcctacaaaattaccactcag
ggtgaacaaatcacgctgagctctccaagcccatacggcacaattcacggcatcgaaacc
cttttacagctcgttgaaaccacagcgactggctaccatattcctgccgtaacaattgtc
gatgagccccgtttccgctggcgtggtgtttcttacgatacgtcacgtcacttcattgaa
ttcgatgtacttattcgtcagttagatgcgatggcgtcggcgaagatgaacgtgttccat
tggcacttctgggacgatcaaggcattcgaattcaaacggaatcttggccgcgtctgtgg
tctgaaactgccgatggtaattactacaccaaagaccaagttcgctacttagttgaatac
gcccgtaatcttggtattcgtgttattcctgaggtctctcttccggggcactcttctgcg
gttgctcacgcttacccgcgtttgatgtcgggcggtgaagggcaaaactacgagcaagaa
agagggtggggcgtgtttgaaccgctcatggatccactgaacccagaagtctatgagatg
cttggtgatgtgtttgatgaagtgaccgagctgttccctgatgagtacttccacattggt
ggcgatgagccgaattatgcacagtggaaaaacagcgaaaagcaccaacagttcattgaa
gaaaacaatatcgatggcgagcgtggtctgcagtcttacctcaatgtaaaagttgagaag
atgctcgaagagcgcggtaagaagatgacgggttgggatgagatttggcataaagacctg
ccgacttccatcgtaattcaaagctggcaagggcacgatagcattggtcgtgcggcgaaa
gagggctacccaggtattctttctacaggttactacctagatcagcctcagccgactagc
taccactatcgcaatgacccaatgccaactggcatcacagttgacgataagctgcacagt
ggcgaaaagttcgtgacgtatcaatggcagaagccacgttcaaaaggcggcccacgtaag
ggaacactgactattattgaagggaaagacggcactttccgcgcattcagtgattataac
ggcaagtctcgtgaagagatctacatccttgattatgtaccgggtaaaacctttgtcggt
cacttcgataacttcatgtcgtacaccgagttcaacctaaacctaaatcccaagggtttt
accgaaggcagttaccaattggtcggtaatgtgcgttggccaaccacaggtgaagtgatt
gcgagcagtgatgttgaaggcagcgtgattcctgaaccaaatggtggttaccctgcagaa
ttaaccgacaaagaaaaagagcttatcttgggaggcgagatcaccatgtggctagagaat
aaagacagcctcacggttgaaaactacctatggccgcgcagctatgcgattgcagagcgc
ttctggtctgatgcggaattgacggacgaacgcagcatgtacaagcgcatgaaagcgatg
gatacatggtctgaagtgtcggttgggctgcgtcaccatgcggatgctgacatgttgtta
aaacgcattgccaaagggcaggatatccacgacctgcgcgtgcttgccaagtacaccgag
ccagcacaatactacgcgcgtaactgggagaagtggaactctactgaacctaagggcact
ttatacagccaatacgagcgtctaaatcgcttcgtggatgcactgccagtggaaagctac
gctgtgtatgaaatgcaagatttggtcagtgaagtcgcgacgggtaatcaacaagcgctt
gagcaactcgctcagcattatcagcaagcaaaagcggctgcactcgcggctaaaactgtc
ttcgcaggtaatgtgtcttcggtagagactgtggtagtcgcagagaaaacggcggaagtc
gcagacttggcgttaaccttgattgctaaagcacaagcgggcgaaaaagttcgagcatca
gatgcgaacgcctaccaagcgatactgtttgaatcagcgaagatctacgacgaatcgatc
atcgcgattgttcgcccgacagagctcttgttgaagcagttagctgagtaa

DBGET integrated database retrieval system