KEGG   Vibrio splendidus: VS_II0097Help
Entry
VS_II0097         CDS       T00812                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vsp  Vibrio splendidus
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vsp00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:106826..108265
Genome map
AA seq 479 aa AA seqDB search
MNNEFPNDFLWGGAVAAHQLEGGWDANGKGVSVVDVLTAGAHGVQRRITDGVIDGENYPN
QVAVDFYHRYKEDIKLFAEMGFKCFRTSIAWTRIFPNGDDAEPCEAGLAFYDDLFDELLK
YDIQPVVTLSHFEMPYHLANEYGGWMNRKVIDFFVKYSTTVMDRYQHKVKYWMTFNEINN
QMNTSADIFGWLCSGVKFPQCEKPQEAMYQAVHHQFVASALVVKKGHEINPELQIGAMCA
MVPFYPRSSKPEDIMVAQQAMRDRYFFSDVMVRGHYPNYAKRDWAIKGFNIEMQPEDEQI
LKEGKADYLGFSYYMSNTLDSSSHQSTEEAMDGGHENSVDNPFIQSSDWGWPIDPTGLRF
CLASLYERYEVPLFIVENGFGAVDTIEEDGSINDDYRIAYLGDHIKEMKKAVAIDGVDLM
GYTPWGCIDLVSFTTGEMKKRYGFIYVDKHNDQSGSLERKRKKSFEWYKGVIASNGATI
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgaatttccgaacgattttttatggggtggcgcggttgcggcgcatcagtta
gaaggcggctgggatgcgaatggtaaaggtgtgagtgtcgttgacgtattaacggcaggt
gctcatggtgtacaacgtcgaatcaccgatggtgtgattgatggcgaaaactaccccaac
caagtggctgttgatttctaccaccgctacaaagaggacattaagttattcgctgaaatg
ggctttaagtgtttccgtactagtatcgcgtggacgcgtatcttcccaaatggcgatgac
gctgagccgtgtgaagcgggtttagcgttttacgatgatctgtttgatgagctgttgaaa
tacgatattcaacctgtggtcacactgagccactttgaaatgccttaccatctagctaac
gaatatggcggctggatgaaccgcaaagtgatcgacttcttcgttaagtactcgactacg
gtaatggatcgttatcagcacaaagtgaaatactggatgacgtttaacgagatcaacaac
cagatgaatacctctgcggatattttcggttggttatgctcgggcgtgaagttcccacaa
tgtgaaaagccgcaagaggcgatgtatcaagcggttcaccaccagtttgttgccagtgcg
ttggtggttaagaaaggtcacgagatcaacccggagcttcaaattggcgcaatgtgtgcg
atggtgcctttttatcctcgttcttctaaaccggaagacattatggtggcacagcaagcg
atgcgtgaccgttacttcttctcggacgtgatggtgcgtggtcattacccaaattacgct
aagcgtgactgggcaatcaaaggcttcaacattgagatgcagcctgaagatgagcagatc
ctaaaagaaggtaaagccgattacttaggctttagctactacatgtcgaataccttggat
tcttcttcgcaccaatcgactgaagaagcgatggacggcggtcatgaaaactcggtcgat
aacccgtttatccagtctagcgattggggctggccaattgatccaacgggtttacgtttc
tgtttagcgtctctgtatgaacgttatgaagtgccattgttcatcgttgaaaacggtttt
ggcgcagttgataccattgaagaagatggcagcattaatgacgactatcgcattgcttac
cttggcgaccacatcaaagagatgaaaaaagccgttgcgattgatggtgttgatttgatg
ggttacaccccttggggctgtatcgacttagtgtcgttcaccacgggcgagatgaaaaaa
cgctacggattcatttacgtagataagcacaacgatcaatctggctcacttgaacgcaaa
cgcaagaagtcgttcgagtggtataaaggcgtgattgcatctaacggtgccactatttag

DBGET integrated database retrieval system