KEGG   Vibrio splendidus: VS_II0139Help
Entry
VS_II0139         CDS       T00812                                 

Definition
Sugar (pentulose and hexulose) kinases
Orthology
K00880  
L-xylulokinase [EC:2.7.1.53]
Organism
vsp  Vibrio splendidus
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:vsp00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:vsp00053]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(148733..150226)
Genome map
AA seq 497 aa AA seqDB search
MNYYIGIDSGGTFMKAALFNAKGEQQGLARVSASVINEKQGWVERDLNALWGNAVDVIKQ
LLETTKVEPTSIKGLSISAQGKGVYLLDKEGQNLGHGIMSSDSRSLPIVKEWLEQGKAQE
IYPTTLQTLWTGHPVSIVRWIKENDAERYNNIGAVMMSHDYLRYRLTGEVAAELTNISES
NFFNSITGEYDKALLETFGIEEIWDALPPVVKPQQQAGKITAAVANETGLAIGTPVFGGL
FDVVSTAICSGINSSEDTLNYVMGTWAVTSGISKQVTQESHNFVYGHYAVDNEYIIHEAS
PTSAGNYEWFADYLGENGQINHQQNQALVEALDPALSSIYFVPFLYGSNQGLGLKSGFYG
LQSHHTKGHLIQAIWEGILFCHNIHLERMRQRFPKANILKVTGGPASSPVWMQMLADLTG
MTVEISDVDETGSLGAAMMAMVGAGEFASLEECTQAITNSTSRVEPNPEHYDTYQKKYKH
YQRLVQLFKQFEDEMDA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaattactacattggaattgattctggcggcacttttatgaaagccgcgttgtttaac
gcaaaaggtgaacaacaaggtcttgcccgcgtatcggcgagcgtcatcaacgaaaaacaa
ggttgggtagaacgcgacctaaacgcactatggggtaacgctgtcgatgtcattaagcag
cttttagagaccacaaaagtagaaccgacctctatcaaaggcttgagcatttcagcccaa
ggcaaaggcgtttaccttcttgataaagagggacaaaacctcggccacggcattatgtct
tctgactcgcgttcactgcctatcgttaaagagtggctagaacagggtaaagcacaagag
atctatccaaccacactgcaaacactgtggacaggtcaccctgtatcgattgttcgctgg
atcaaagagaacgatgccgaacgatacaacaacattggcgcagtgatgatgtctcacgac
taccttcgatatcgcttaacgggcgaagtcgcagcagaactgaccaatatttcagaaagt
aattttttcaactccatcactggtgagtatgacaaagcacttttggaaacctttggcatc
gaagaaatttgggatgcgctaccacccgttgtaaaacctcaacagcaagcagggaaaatc
actgcggccgttgctaatgaaaccggactagcaataggtacgccggtgttcggcggtttg
tttgatgttgtgtctaccgcgatctgttctggaatcaactcttcagaagataccctgaat
tacgtaatgggcacatgggcggtcacgtctggcatatcaaagcaagtaacgcaagaaagc
cacaattttgtttacggccattacgccgtcgataacgaatacatcattcacgaagcgagc
ccaacttctgctggtaattatgaatggttcgccgactaccttggtgaaaatggccagatt
aaccaccagcaaaatcaagcgttagtcgaagcattagatccggcattaagcagtatctac
tttgtgccattcctttacggttcaaaccaaggacttggtctaaagtcaggcttctatggt
ctgcaatcgcaccatactaaagggcacctaattcaagccatttgggaaggcattttattc
tgtcacaacattcacctagaacgtatgcgtcagcgttttccaaaagccaacatactaaaa
gtgacaggcggaccagcatctagccctgtatggatgcaaatgctggctgaccttaccggc
atgaccgttgaaatatcagacgtagatgaaaccggctcattaggtgccgcaatgatggca
atggtcggcgcaggtgagttcgcttcattagaagaatgtactcaagccatcactaattct
acgtcacgtgtcgagccgaatcctgaacactacgacacttaccaaaagaaatataagcac
tatcaaagactggtgcagttgtttaaacaatttgaggatgaaatggatgcctag

DBGET integrated database retrieval system