KEGG   Vibrio splendidus: VS_II0185Help
Entry
VS_II0185         CDS       T00812                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vsp  Vibrio splendidus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VS_II0185 (malQ)
Enzymes [BR:vsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     VS_II0185 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:210088..212268
Genome map
AA seq 726 aa AA seqDB search
MKEQTVLKQVAEMANIADSYVSAWGDEAQVSEETITSLLASLGYDTSSDDALLKSAERKH
RKDVLDPVLVLRDGEPVEVTLNLGVSARESEFSWRLETEQGEVLEGYLQSQVVRDERAEG
GPLVFALPSDLAWGYHKLIVSRKRRKKPYEMTLIITPKACFKQSPIEQGKKLWGPSVQLY
TLRTQHNWGIGDFGDLKQLVSDIASRGGDFVGLNPIHSLFPANPEGASPYSPSSRRWLNV
LYIDVSSVPEFALSAEAQQTVGSAEFQQRLQKAREAHWVNYTEVSELKMSILPLLFAEFK
TRHLDKNSDRAQAFLAFVEEGGESLMHQAAFDALHGELHAEDSGMWGWPVFPEKFRTFES
PATQKYIKDNLDQVHLYMYLQWLADCQINDAQSLAEEKGMVVGLYRDLAVGVADSGSETW
ADEGNLVMDASIGAPPDILGPLGQNWGLPPLNPEVLQETGYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGENATKGAYIYYPVQDMLSILALESHRYQCSVIGEDLGTVPDEIVD
ILADAGVHSYKVFFFETSENDGGFISPKHYASQSMAALCTHDMPTLRGFWHCDDLKMGQE
IGLYPDAQQLETLFDNRLECKQGILDSVAWHGFLPEGVGRDASQVPMDSYLAEALQLHVA
AGGSTLLSVQLEDWLEMDKPVNIPGTVDEYPNWRRKLSMNLDEIFAHEGVNRIASKLTDV
REKAAK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacagaccgtattaaaacaagtcgcagaaatggcaaatattgccgatagttac
gttagtgcgtggggcgatgaagcacaagtatcagaagagacgattacgtctctattggct
tcattgggctacgatacaagcagcgatgatgcactgcttaaatctgcagaaagaaagcac
agaaaagatgtactagacccggttcttgtcttgcgtgacggtgagccagtagaagtgaca
ctcaatctgggtgtgagtgctcgtgaaagtgagttcagctggcgcttagaaaccgagcaa
ggagaggtacttgaaggctatcttcaatctcaagtcgttcgtgacgagcgtgccgagggt
ggccctttagtgtttgcattgccaagtgatttggcatggggttatcacaagctcattgtg
agtcgtaagcgccgtaagaaaccttacgagatgacgttgattattacgcccaaagcatgc
ttcaagcagtcacccattgagcaaggcaaaaagctttggggaccaagtgttcaactgtac
acgctaagaactcagcacaactggggtattggtgatttcggtgacctaaaacagcttgtt
tcggatatcgcgtctcgcggtggtgactttgttggtctaaacccaattcactcactgttc
cctgcaaacccggaaggtgcgagcccatacagcccgtcttcacgtcgttggttgaacgta
ttatacattgatgtgagttcagttcctgagttcgcattaagcgcggaagcgcaacaaacg
gtaggcagcgccgagttccagcagcgcctacagaaagctcgtgaagcgcactgggtgaat
tacactgaagtgtctgagctgaagatgagcatcttacctctgctattcgcagaatttaag
actcgtcatctagacaaaaacagcgaccgcgcacaagcgttcttagcgttcgttgaagag
ggcggtgaaagcctgatgcatcaagccgcgtttgatgctctgcacggtgaactgcatgct
gaagattcaggtatgtggggctggcctgtattcccagagaaattccgtacatttgaaagc
cctgcgacccagaaatacatcaaagataacctagatcaagtgcatctctacatgtaccta
caatggttagccgattgccaaatcaacgatgcacagtctcttgctgaagagaaaggcatg
gtggttggactgtaccgtgacttagcggtaggcgttgcagattcaggcagcgagacatgg
gctgatgaaggcaacctagtgatggatgcgagcattggtgctccaccggatattcttggt
cctctaggccaaaactggggcttaccgccactaaacccagaagtacttcaagaaaccggc
tacgacgcttacatcaaactacttcgtgccaacatgaagcactgtggtgcattgcgtatt
gaccatgttttaggtctgctgcgtttgtggtggattccaaagggtgagaacgcaacgaaa
ggtgcgtacatctactacccagtgcaagacatgctgtctattctggcgcttgaatctcac
cgttaccaatgcagcgttatcggtgaagatttagggacggtaccggatgaaatcgtagac
atccttgctgatgctggcgtgcattcttacaaagtcttcttcttcgaaacatcagaaaat
gacggtggttttatttctccgaagcactacgcgtcacaatcgatggcagcactgtgtact
cacgatatgccaacgcttcgcggcttctggcactgtgatgacttgaaaatgggtcaagag
attggtttatacccagacgcacaacagctagaaactttgttcgataaccgcttggagtgc
aagcaaggtatcttagactcagtggcatggcacggcttcctaccagaaggtgttgggcgt
gatgcaagtcaagtaccgatggattcttatcttgctgaagcgcttcagttgcacgttgcg
gctggtggctcaacactcctgagtgttcagttggaagattggctagagatggataagccc
gttaacatccctggtacggtcgatgagtaccctaactggcgtcgtaaactatcaatgaac
ttggacgaaatcttcgctcatgaaggcgtgaatcgtatcgcctctaagctaactgacgta
cgagaaaaagcagctaaataa

DBGET integrated database retrieval system