KEGG   Vibrio splendidus: VS_II0186Help
Entry
VS_II0186         CDS       T00812                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vsp  Vibrio splendidus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VS_II0186
Enzymes [BR:vsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     VS_II0186
Exosome [BR:vsp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VS_II0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:212444..214624
Genome map
AA seq 726 aa AA seqDB search
MELSSISKQKQIYTQLSQACFTDPFAFLGPYLPSEHGSLRVWIPGADKVELIVGKEPRIK
LAREGESGFILKQERDLRFTHYKLAVDWNGVEQIIDDPYQYHDLYASYEDLHTPKDMYHH
MGAQFITLERDGQTISGTRFLVYAPHATAASLVGNFNAWDGRRHPMQRLDYGMWGLFIPD
LEEGAQYKFELKGPDGEGLPHKADPWGFYSEQYPSFSSVTYDHARYQWQDSQWQNRPVTQ
KRKEALSFYELHTGSWKRNAEGEFLNYRELAAELIPYLTDLGYTHVELMPVSEHPFYGSW
GYQPIGLFAPTSRFGSPDDFKFFVDQCHQAGLGVVLDWVPAHFPSDDHGLANFDGTPLFH
DPDPRRGWHQDWNSYIYDLGKEHVRRFLVANALYWFEQFHIDGIRVDAVASMLYLDYSRS
HDQWIPNVDGGNENYDAIATLKWMNEEVYKHFPNAMTIAEESTAFPGVSAPTFMGGLGFG
FKWNMGWMHDSLSYIQEDPINRKYHHDTITFPLVYAHSENYVLSLSHDEVVYGKGSIHNK
MPGDEWQQTANLRAYMGYMYAQPGKKLNFMGAEFGQTAEWNHDDQLQWFLLEYERHQGVQ
RLTKDLNNLYRSEAAMHDLDFDPKGFEWRLQDSAEASILAHERISESGERVLVVSNFTPV
PHERFRLGVPAQGQYSLLLNTDSADYAGSGFEVKQVAEVESIASEGLDTSIELRLPPLST
VFYKLN
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
ttggaactaagttcgatttcaaagcaaaaacaaatatatacccaactatcacaggcttgc
ttcacagacccatttgcgtttttagggccatacttaccttctgaacatggttcattacga
gtgtggattcctggggcagataaagtcgagttgattgttggaaaggaacctcgtattaag
ttagcgcgagagggtgaaagtggtttcattcttaagcaagaaagagacttacgttttact
cactacaagcttgcggttgattggaatggagtagagcagatcatcgatgatccataccaa
taccatgatctgtacgcgagttatgaggatcttcatacacctaaagatatgtatcatcac
atgggagctcagtttattacgctagagcgtgatggacagacgatttcaggcacgcgtttc
ttggtgtacgcaccgcatgcaacagcggctagcttggtgggtaacttcaacgcttgggat
ggtcgtcgccacccaatgcagcgtctagattatggtatgtggggcttatttattcctgat
ctggaagaaggcgcacaatacaagtttgaattaaaaggacccgatggcgaaggcttgcca
cataaagctgacccatggggtttctactctgagcagtatccatctttttcatctgtgact
tacgatcacgctcgctaccagtggcaagattctcaatggcagaatcgcccggtcacgcaa
aagcgcaaagaagccctttcattctatgaattgcataccggctcttggaagcgcaatgct
gaaggtgaattcctaaactaccgtgagctagcggcagagctaatcccatatctaacggat
ctcggttacacacacgtagagttgatgccggtttcagagcacccgttttacggctcttgg
ggttatcagccaataggcttgtttgcgccaacaagtcgttttggttctccagatgatttc
aaattcttcgtcgaccaatgtcaccaagccggtttaggtgttgttctggactgggttcct
gcacactttccaagtgatgatcacggcttagctaactttgatggaacgcctttgttccat
gatccagatccacgccgtggttggcaccaagattggaactcgtacatttacgacttaggt
aaagagcatgttcgtcgcttcttagtagcaaatgcattgtactggttcgaacaattccat
atcgatggcattcgtgttgatgcggttgcttcgatgttgtacctcgattactcgcgtagc
catgatcagtggattccgaatgttgacggcggcaatgaaaactacgacgctatcgcgacc
cttaagtggatgaacgaagaagtgtacaaacacttcccgaatgcgatgacaattgctgaa
gaatcgacggctttcccaggtgtttcagcaccaacctttatgggcggtttaggcttcggt
tttaagtggaacatgggttggatgcacgatagcttgtcttacattcaagaagatccaatc
aaccgtaaatatcaccacgatacgattaccttcccgttggtttatgctcacagcgaaaac
tacgtattgtctctgtctcacgatgaggttgtttacggtaaaggctctatccacaacaag
atgccgggtgatgagtggcagcaaacggctaacctacgcgcttacatgggttacatgtat
gcacaaccgggtaaaaagctgaacttcatgggcgctgaattcggtcaaacggctgaatgg
aatcatgatgatcaactgcagtggttcttgttggaatatgaacgccaccaaggtgttcaa
cgcttaacgaaagatttgaacaatctataccgctctgaggcggcaatgcacgatcttgat
ttcgacccgaaaggttttgaatggcgtctacaagattctgctgaagcaagtatcttagct
catgaacgtattagtgagtcgggtgaacgcgtgttggttgtttctaactttacgcccgtt
cctcatgagcgtttccgcttaggtgttccagcccaaggccagtactcgctattgctgaat
actgactcggctgattacgcaggcagcggttttgaagtgaagcaggttgctgaggttgaa
tcaatagcaagcgaaggtttggacacgtcgattgagctgcgtttgccacctctttcaacg
gtgttttacaaattaaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system