KEGG   Vibrio tasmaniensis: VS_II0266Help
Entry
VS_II0266         CDS       T00812                                 

Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00620  Pyruvate metabolism
vsp00630  Glyoxylate and dicarboxylate metabolism
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01120  Microbial metabolism in diverse environments
vsp01200  Carbon metabolism
Module
vsp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VS_II0266
   00630 Glyoxylate and dicarboxylate metabolism
    VS_II0266
Enzymes [BR:vsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VS_II0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: CAV25647
UniProt: B7VQN4
Position
2:306613..308796
Genome map
AA seq 727 aa AA seqDB search
MSSRIQQGSLNIDSTLYQLINEQVIPGTGIVAEDFWQSFATILEDLAPKNRALLIKREDL
QHQIDVWHQERAGQTLDAAEYKQFLQQIGYLVPEGDDFQVTTTSVEPEIATQAGPQLVVP
IMNARFALNAANARWGSLYDALYGTDVISESDGAEKGGSFNPVRGAKVVSYARGFLDDAA
PLNGVSHKDVTKYSISNVSIGNTLTATLDNGEEVTLIDRNQFIGYQGDASAPSSILLKHN
NLHIEIQIDPSAPIGSVDVAGIKDVLVESALTTIMDCEDSVAAVDGEDKALAYRNWLGLM
KGDLQESLEKNGKTIVRNLNPDRQYTSVTGGEISLKGRSMLFIRNVGHLMTNPAIIDADG
NEVPEGIMDGMITSLIAMHDLKGNSAYQNSTANSINIVKPKMHGPEEVAFTNELFGRIED
ALGLDRFTIKVGIMDEERRTSVNLKECIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPFA
PKTQLKTMTWIGAYEDQNVDLGLACGLQGKAQIGKGMWPEPDNMAKMMDAKIGHPQAGAN
TAWVPSPTAATLHALHYHKVSVPSRQKELRERVRANVDDILTIPLLGNQKLTAQDIQNEL
DNNTQGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHGICNEAQV
MKTMKRMAAVVDEQNASDPSYRNMAPDFENSIAFSAACQLVFEGCAQPSGYTEPVLHAMR
LKLKAQG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcgtattcaacagggaagcttgaacattgatagcaccctctaccaattaatt
aatgagcaggtcattcctggaacaggcattgtcgctgaagacttttggcaatcatttgca
actatccttgaagacttggctcccaagaaccgcgcactgcttatcaagcgtgaagatctt
caacatcaaattgacgtttggcaccaagagcgtgcgggacaaacgctagatgcggccgag
tacaaacagttcttacagcagattggctacttagttcctgagggtgatgactttcaagta
acgactaccagcgttgagcctgaaattgcaacacaagcgggtccgcagcttgttgtacct
attatgaatgcacgttttgcacttaacgcggctaatgcgcgttggggaagtttatacgat
gcgctctacggaaccgatgtcatcagtgaaagtgacggcgcggaaaagggaggaagcttt
aacccggtacgcggtgctaaagtggtgagctacgctcgaggtttccttgatgacgctgca
ccgttaaacggtgtatctcataaagacgtcaccaaatacagcatcagcaatgtcagtatt
ggcaatacactgacagcgaccttagacaatggcgaagaagtcactctaatcgatcgcaac
cagttcattggttaccaaggtgatgcgagtgccccttcaagtattctgcttaagcacaac
aacctacatattgaaattcaaattgacccgagcgcgccaattggcagcgttgatgtagct
ggcattaaggatgtgctggtggaatcggctctcactaccattatggattgcgaagattcg
gtagcagcggttgatggtgaagacaaagcattggcttaccgcaactggttaggcttgatg
aaaggtgacttacaagagtcactagagaaaaatggcaagaccatcgttcgtaacctcaac
ccagatcgtcaatacaccagcgtgacgggaggcgagatctcgctgaaaggccgcagcatg
ttgtttatccgcaatgtgggccatctaatgaccaaccctgccattattgatgctgacggt
aatgaagtacctgaaggtattatggatggcatgatcacttcactaatcgcgatgcatgat
ttaaaaggcaacagcgcgtaccaaaactcgaccgcgaacagtatcaatattgtaaaacct
aagatgcatggtcctgaagaagtcgcgttcaccaatgagctgtttggccgcattgaagat
gcattagggctagatcgattcacgatcaaagtcggcatcatggacgaagagcgtcgtact
tcagtcaatcttaaagagtgtattcgagcggctaaagatcgtgttgtgtttatcaacaca
ggtttcttagaccgaacgggtgatgaaattcacaccagtatggaagcgggtccgtttgct
cctaaaacacagctgaaaaccatgacttggattggcgcttacgaagatcaaaacgttgat
cttggcttagcttgtggcctgcaaggtaaagcccagattggtaaaggtatgtggccagag
ccagacaatatggccaagatgatggacgcgaaaatcggacatcctcaagcgggcgcaaat
acagcttgggttccttctccaactgccgcgactttgcatgccttgcactatcacaaggtg
agtgtaccaagccgccagaaagagcttcgtgagcgtgtgagagcaaatgttgacgatatt
cttactatcccattgctaggtaatcaaaagctgaccgctcaagatatccaaaacgaattg
gacaacaatacgcaaggtattcttggttatgtagtgcgttggattgaccaaggcgtcggg
tgttctaaggtgccagatattaacgatgtaggtttgatggaagaccgcgctacgctgcgt
atttcgagccaacacattgcgaactggttacgtcatgggatttgtaatgaagcccaagta
atgaaaaccatgaagcgcatggccgcagtagttgacgagcaaaacgctagcgacccgagc
taccgtaatatggcacctgactttgaaaacagcatcgcattttcagcagcgtgtcagttg
gtattcgaaggctgcgctcaacctagtggttacaccgagccagtgctgcatgctatgcgt
ctaaaactgaaagcgcagggatag

DBGET integrated database retrieval system