KEGG   Vibrio splendidus: VS_II0266Help
Entry
VS_II0266         CDS       T00812                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vsp  Vibrio splendidus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VS_II0266
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VS_II0266
   00630 Glyoxylate and dicarboxylate metabolism
    VS_II0266
Enzymes [BR:vsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VS_II0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:306613..308796
Genome map
AA seq 727 aa AA seqDB search
MSSRIQQGSLNIDSTLYQLINEQVIPGTGIVAEDFWQSFATILEDLAPKNRALLIKREDL
QHQIDVWHQERAGQTLDAAEYKQFLQQIGYLVPEGDDFQVTTTSVEPEIATQAGPQLVVP
IMNARFALNAANARWGSLYDALYGTDVISESDGAEKGGSFNPVRGAKVVSYARGFLDDAA
PLNGVSHKDVTKYSISNVSIGNTLTATLDNGEEVTLIDRNQFIGYQGDASAPSSILLKHN
NLHIEIQIDPSAPIGSVDVAGIKDVLVESALTTIMDCEDSVAAVDGEDKALAYRNWLGLM
KGDLQESLEKNGKTIVRNLNPDRQYTSVTGGEISLKGRSMLFIRNVGHLMTNPAIIDADG
NEVPEGIMDGMITSLIAMHDLKGNSAYQNSTANSINIVKPKMHGPEEVAFTNELFGRIED
ALGLDRFTIKVGIMDEERRTSVNLKECIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPFA
PKTQLKTMTWIGAYEDQNVDLGLACGLQGKAQIGKGMWPEPDNMAKMMDAKIGHPQAGAN
TAWVPSPTAATLHALHYHKVSVPSRQKELRERVRANVDDILTIPLLGNQKLTAQDIQNEL
DNNTQGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHGICNEAQV
MKTMKRMAAVVDEQNASDPSYRNMAPDFENSIAFSAACQLVFEGCAQPSGYTEPVLHAMR
LKLKAQG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcgtattcaacagggaagcttgaacattgatagcaccctctaccaattaatt
aatgagcaggtcattcctggaacaggcattgtcgctgaagacttttggcaatcatttgca
actatccttgaagacttggctcccaagaaccgcgcactgcttatcaagcgtgaagatctt
caacatcaaattgacgtttggcaccaagagcgtgcgggacaaacgctagatgcggccgag
tacaaacagttcttacagcagattggctacttagttcctgagggtgatgactttcaagta
acgactaccagcgttgagcctgaaattgcaacacaagcgggtccgcagcttgttgtacct
attatgaatgcacgttttgcacttaacgcggctaatgcgcgttggggaagtttatacgat
gcgctctacggaaccgatgtcatcagtgaaagtgacggcgcggaaaagggaggaagcttt
aacccggtacgcggtgctaaagtggtgagctacgctcgaggtttccttgatgacgctgca
ccgttaaacggtgtatctcataaagacgtcaccaaatacagcatcagcaatgtcagtatt
ggcaatacactgacagcgaccttagacaatggcgaagaagtcactctaatcgatcgcaac
cagttcattggttaccaaggtgatgcgagtgccccttcaagtattctgcttaagcacaac
aacctacatattgaaattcaaattgacccgagcgcgccaattggcagcgttgatgtagct
ggcattaaggatgtgctggtggaatcggctctcactaccattatggattgcgaagattcg
gtagcagcggttgatggtgaagacaaagcattggcttaccgcaactggttaggcttgatg
aaaggtgacttacaagagtcactagagaaaaatggcaagaccatcgttcgtaacctcaac
ccagatcgtcaatacaccagcgtgacgggaggcgagatctcgctgaaaggccgcagcatg
ttgtttatccgcaatgtgggccatctaatgaccaaccctgccattattgatgctgacggt
aatgaagtacctgaaggtattatggatggcatgatcacttcactaatcgcgatgcatgat
ttaaaaggcaacagcgcgtaccaaaactcgaccgcgaacagtatcaatattgtaaaacct
aagatgcatggtcctgaagaagtcgcgttcaccaatgagctgtttggccgcattgaagat
gcattagggctagatcgattcacgatcaaagtcggcatcatggacgaagagcgtcgtact
tcagtcaatcttaaagagtgtattcgagcggctaaagatcgtgttgtgtttatcaacaca
ggtttcttagaccgaacgggtgatgaaattcacaccagtatggaagcgggtccgtttgct
cctaaaacacagctgaaaaccatgacttggattggcgcttacgaagatcaaaacgttgat
cttggcttagcttgtggcctgcaaggtaaagcccagattggtaaaggtatgtggccagag
ccagacaatatggccaagatgatggacgcgaaaatcggacatcctcaagcgggcgcaaat
acagcttgggttccttctccaactgccgcgactttgcatgccttgcactatcacaaggtg
agtgtaccaagccgccagaaagagcttcgtgagcgtgtgagagcaaatgttgacgatatt
cttactatcccattgctaggtaatcaaaagctgaccgctcaagatatccaaaacgaattg
gacaacaatacgcaaggtattcttggttatgtagtgcgttggattgaccaaggcgtcggg
tgttctaaggtgccagatattaacgatgtaggtttgatggaagaccgcgctacgctgcgt
atttcgagccaacacattgcgaactggttacgtcatgggatttgtaatgaagcccaagta
atgaaaaccatgaagcgcatggccgcagtagttgacgagcaaaacgctagcgacccgagc
taccgtaatatggcacctgactttgaaaacagcatcgcattttcagcagcgtgtcagttg
gtattcgaaggctgcgctcaacctagtggttacaccgagccagtgctgcatgctatgcgt
ctaaaactgaaagcgcagggatag

DBGET integrated database retrieval system