KEGG   Vibrio splendidus: VS_II0324Help
Entry
VS_II0324         CDS       T00812                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vsp  Vibrio splendidus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VS_II0324
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VS_II0324
   00630 Glyoxylate and dicarboxylate metabolism
    VS_II0324
Enzymes [BR:vsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VS_II0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:368323..368925
Genome map
AA seq 200 aa AA seqDB search
MNMLTFDKTEIQKQTKPFIAEAVFAVETISAKQQTEKQLKAKQLLDRLFPLENGSHQDVT
SYVVDYRHIMAYFKNGQHSGLKHPKQFVAYMGEKCDPDSILFRDSSGSHLEVMFGCHKGT
GCIELVDIDDIQLESCTTFGQSPMEVVQTNTERQGITTAIRHWISLVQGDEKGKPKACSE
DKEFRAKSGEDYCLNYCYAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgacattcgataaaacagaaatccaaaaacaaacaaaaccatttatcgct
gaagctgtctttgccgtggagactatcagtgccaaacagcaaactgagaagcaactcaaa
gcgaaacaactgctagatagattgtttccattagaaaacggctcacatcaagatgtaacg
agctacgtagttgattaccgccatatcatggcttatttcaaaaatggccaacacagcggt
ctaaagcatcctaagcagtttgtagcttacatgggtgagaagtgtgacccagactcaatc
ttgttccgagatagcagtggaagccatttagaagtgatgtttggttgtcataaagggacg
gggtgcattgaattggtcgatatcgacgatattcagttagagtcatgcactacttttggc
cagtcaccaatggaagtggtacaaacgaatactgagcgtcaaggcatcactacagcaata
cgtcactggatcagcttagttcaaggtgatgagaagggtaaaccaaaagcatgcagcgaa
gacaaagagttccgagctaagagcggtgaagattactgtcttaattattgctacgccctt
taa

DBGET integrated database retrieval system