KEGG   Vibrio splendidus: VS_II0324Help
Entry
VS_II0324         CDS       T00812                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vsp  Vibrio splendidus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:vsp01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vsp00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vsp00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:368323..368925
Genome map
AA seq 200 aa AA seqDB search
MNMLTFDKTEIQKQTKPFIAEAVFAVETISAKQQTEKQLKAKQLLDRLFPLENGSHQDVT
SYVVDYRHIMAYFKNGQHSGLKHPKQFVAYMGEKCDPDSILFRDSSGSHLEVMFGCHKGT
GCIELVDIDDIQLESCTTFGQSPMEVVQTNTERQGITTAIRHWISLVQGDEKGKPKACSE
DKEFRAKSGEDYCLNYCYAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgacattcgataaaacagaaatccaaaaacaaacaaaaccatttatcgct
gaagctgtctttgccgtggagactatcagtgccaaacagcaaactgagaagcaactcaaa
gcgaaacaactgctagatagattgtttccattagaaaacggctcacatcaagatgtaacg
agctacgtagttgattaccgccatatcatggcttatttcaaaaatggccaacacagcggt
ctaaagcatcctaagcagtttgtagcttacatgggtgagaagtgtgacccagactcaatc
ttgttccgagatagcagtggaagccatttagaagtgatgtttggttgtcataaagggacg
gggtgcattgaattggtcgatatcgacgatattcagttagagtcatgcactacttttggc
cagtcaccaatggaagtggtacaaacgaatactgagcgtcaaggcatcactacagcaata
cgtcactggatcagcttagttcaaggtgatgagaagggtaaaccaaaagcatgcagcgaa
gacaaagagttccgagctaagagcggtgaagattactgtcttaattattgctacgccctt
taa

DBGET integrated database retrieval system