KEGG   Vibrio splendidus: VS_II0324Help
Entry
VS_II0324         CDS       T00812                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vsp  Vibrio splendidus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VS_II0324
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VS_II0324
   00630 Glyoxylate and dicarboxylate metabolism
    VS_II0324
Enzymes [BR:vsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VS_II0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:368323..368925
Genome map
AA seq 200 aa AA seqDB search
MNMLTFDKTEIQKQTKPFIAEAVFAVETISAKQQTEKQLKAKQLLDRLFPLENGSHQDVT
SYVVDYRHIMAYFKNGQHSGLKHPKQFVAYMGEKCDPDSILFRDSSGSHLEVMFGCHKGT
GCIELVDIDDIQLESCTTFGQSPMEVVQTNTERQGITTAIRHWISLVQGDEKGKPKACSE
DKEFRAKSGEDYCLNYCYAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgacattcgataaaacagaaatccaaaaacaaacaaaaccatttatcgct
gaagctgtctttgccgtggagactatcagtgccaaacagcaaactgagaagcaactcaaa
gcgaaacaactgctagatagattgtttccattagaaaacggctcacatcaagatgtaacg
agctacgtagttgattaccgccatatcatggcttatttcaaaaatggccaacacagcggt
ctaaagcatcctaagcagtttgtagcttacatgggtgagaagtgtgacccagactcaatc
ttgttccgagatagcagtggaagccatttagaagtgatgtttggttgtcataaagggacg
gggtgcattgaattggtcgatatcgacgatattcagttagagtcatgcactacttttggc
cagtcaccaatggaagtggtacaaacgaatactgagcgtcaaggcatcactacagcaata
cgtcactggatcagcttagttcaaggtgatgagaagggtaaaccaaaagcatgcagcgaa
gacaaagagttccgagctaagagcggtgaagattactgtcttaattattgctacgccctt
taa

DBGET integrated database retrieval system