KEGG   Vibrio tasmaniensis: VS_II0325Help
Entry
VS_II0325         CDS       T00812                                 

Definition
(GenBank) GGDEF family protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
vsp  Vibrio tasmaniensis
Brite
Enzymes [BR:vsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VS_II0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(369191..370228)
Genome map
AA seq 345 aa AA seqDB search
MVSAVKIMKKDEFQKSTANLKKAVPLMMKNRVSTTPANYALWYTYVDNAIPQLTKDMDGI
LEYYGICPPAVGEQLYNNYVASKSETNINDLRANLELLVSEVSNSMNDTLTDTSAFSEMI
DKSFEDLARVDNESLSIDEVMSLVRQLVSESRHIRHSTQFLNSQLNSATSEITKLKSQLV
EVQKDALFDSTTTLYNRRSFDRDIETLCEAKQPLCLILLDIDHFKNFNDTYGHLFGDMVL
KGIARKLKQMCREGISAYRFGGEEFAIIVPNKSLRIARQLADTNRRSLEKLSIKDRRSGQ
QVGSITASFGVAELEPGESAQSLIERADKLLYEAKSLGRNRVMPL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttggtatctgcagtaaaaatcatgaaaaaagacgaatttcaaaaatccaccgcaaatcta
aaaaaagcggtgcctcttatgatgaagaaccgggtgtctactacacctgcaaattatgca
ctttggtacacctatgttgacaatgctatcccacagctgactaaagacatggatggtatc
ttggaatactatggcatttgtcctccagccgttggtgagcagctttacaataattatgtt
gctagcaagtctgaaacgaatatcaatgacctccgcgctaatttagaattgttggtctcg
gaagtttcgaattcgatgaatgacacactgaccgatacctctgctttttctgagatgatt
gataaaagcttcgaggatttggcccgcgttgacaatgaaagtttatcgatcgatgaagtc
atgtctttagttcgtcagttagtttctgaatctcgtcatattcgtcactctactcaattt
ttaaattctcagttgaattctgcgacatcagaaatcactaagctaaagtctcagctagtc
gaagtgcagaaagatgcactctttgacagcacaacgacactctataaccgtcgctctttc
gaccgtgatatagaaaccttgtgtgaagcgaaacaacctctgtgtttaattcttctcgat
atcgatcattttaaaaacttcaacgacacttatggccacctatttggtgacatggttctt
aaaggcattgcgcgcaaattaaaacaaatgtgccgtgaagggatttctgcttaccgattt
ggtggtgaagagttcgcgataatcgtgccaaacaaatcattacgcattgcacgtcagctt
gcagacaccaaccgccgctctctagaaaagctatcgattaaagatcgtcgtagcgggcaa
caggtaggtagcatcaccgcatcgtttggtgttgctgagcttgaacccggtgaatcggca
caatcactgatcgaacgcgctgataagctactttacgaagcgaagtcacttggtcgaaat
agagtgatgccgctgtag

DBGET integrated database retrieval system