KEGG   Vibrio splendidus: VS_II0610Help
Entry
VS_II0610         CDS       T00812                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vsp  Vibrio splendidus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VS_II0610
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VS_II0610
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     VS_II0610
Lipid biosynthesis proteins [BR:vsp01004]
 Desaturase
  First
   VS_II0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(688090..689373)
Genome map
AA seq 427 aa AA seqDB search
MTCYYISHYLYTIFKQNILIHVYTFNIDLHVYADILAHRCKLNGNLLMNSADKQSTKKPP
LIWLNIFVFSFSMLLAVVAAPVYGYFFGYGMEHWIWLAICFTFCNLSITTGYHRLWSHKA
FEAHSSLRFLFSLGGAFALQNSALHWSSDHRVHHKHVDNNDKDPYSAKRGFWYSHIGWMI
RNYSTSMYENYENCRDLKKDKIVMWQHKHYVLLALLMNFGVPIALGVIYGDVLGMLLIVG
AVRLVLNHHTTFFINSLAHIWGSQPFTDKNTARDNGVLAVLTFGEGYHNFHHIFENDYRN
GIYWWQYDPTKWLIKSASLMGLASKLKKTPQARIEKAEASMLLKRTQQKIMHRADKQQIA
DKLQQEFDALVSNMNEYYEVKKQLLESKREDVVKKYEHSLLKVRYQQIKMNFEQQKKNWA
MTVEQYA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacttgctactacatttcacactacctttatacaatatttaagcaaaacatactaata
cacgtttacactttcaatattgacttacacgtgtacgctgatattctagcgcacagatgt
aagctcaatggaaatttgctaatgaatagtgccgacaaacaatctacaaaaaagccgcca
ttaatctggctcaatatttttgtattctcttttagtatgctgcttgctgttgttgcagct
cccgtttatggctacttttttggctatggtatggagcactggatatggctagcgatctgc
tttacgttctgtaacctttcaatcacgacgggttatcatcgcttatggtcacacaaagcg
tttgaagcgcattcaagcctaagattcctgttttcactaggtggcgcatttgccctgcag
aacagcgcgttacactggtcttctgatcaccgtgtgcaccacaagcatgtagataacaac
gacaaagacccatactcagcaaaacgtggtttttggtattctcacatcgggtggatgatt
cgtaactacagcacctcgatgtatgaaaattatgaaaattgtcgagatttaaagaaagac
aaaattgttatgtggcagcacaagcactatgttctgttggcattgctaatgaacttcggt
gttcctatcgctttaggtgttatttacggtgacgtacttggcatgttgttaatcgtaggt
gctgttcgtttggtgcttaaccatcacacgacattcttcattaactctcttgctcacatc
tggggtagccaaccttttaccgacaaaaacacggcccgtgataacggtgtgttagcggtt
ctaacttttggcgaaggctaccacaacttccaccacatctttgagaacgattaccgcaac
ggcatctactggtggcaatacgatcctacaaaatggttgatcaagagtgcttctttgatg
ggattggcaagcaagcttaagaaaacccctcaagctcgtatcgaaaaagcagaagcatca
atgttacttaaacgcacgcagcaaaagatcatgcatcgtgccgacaagcagcaaatcgcg
gacaaacttcaacaagaattcgatgctctagtatcaaacatgaacgagtattacgaagtc
aaaaagcagctacttgaaagcaaacgcgaagatgttgtgaagaagtacgaacactctcta
cttaaagttcgttaccaacaaatcaaaatgaattttgagcaacagaaaaaaaattgggca
atgacagtggaacagtatgcttaa

DBGET integrated database retrieval system