KEGG   Vibrio splendidus: VS_II0656Help
Entry
VS_II0656         CDS       T00812                                 

Definition
methylamine utilization protein mauG
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vsp  Vibrio splendidus
Brite
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VS_II0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:724495..725568
Genome map
AA seq 357 aa AA seqDB search
MSIALKSLVGVCALFSATLYAALPPISINTAKAELGKRLFFDTRLSGDDSISCSSCHIPS
NGFSYPEPLSPAYTGSDGFRNAPTLINTAYKEVWFHDGRIGTNLNDVVRENITEDWLMNM
DMRLMQERLKQDPIYVEMFKAANLGEPSNGGVRKALPEYLKTLTSKNVPFDKGELSDLAS
QGEKLFTGKAGCSQCHSGALFSDGKAHNTGVPENHEIFLDPMRHQSFLAYNMFMGVQDYL
TLKRDVGAHVQTHKADGSDRGKFITPTLRELSQTAPYMHNGMLATLEDVVEFYNQGGGED
SNKDSRLTTLSLTDYEKKALVAFLESLSGDALIGEEYEWLDYDFGYEYTEDWSNARN
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgcactaaaaagcttggtaggagtgtgtgcccttttctctgcaactctatac
gccgctctgccccctataagtataaatacggcgaaggcagaactcggtaaacgactgttt
tttgatacgcgcttgtctggggacgactcgatatcgtgctccagttgccacattccatct
aatggtttttcttaccctgaaccgttgagccctgcctatacggggagtgatggatttcgc
aatgctccaacacttattaatacagcctataaagaggtgtggtttcacgatggtcgtatt
ggcaccaacctaaacgatgtggtgcgggagaatatcactgaagactggctgatgaatatg
gacatgcgtttgatgcaggaacgcctcaaacaagacccaatatacgttgagatgtttaaa
gcggccaatcttggagaaccgtcaaatggcggagtacgcaaagctctgcctgaataccta
aaaacattgacttcgaagaatgtcccttttgacaagggtgagcttagcgacttagcgagc
cagggagaaaaactgttcacaggcaaagcggggtgcagccaatgccatagtggcgcgctg
ttttcggacggaaaggcacacaataccggagtgccagaaaatcatgagatatttttagac
cccatgcgacatcaatcttttcttgcctacaacatgtttatgggtgtgcaagattactta
acgttaaagcgcgatgttggtgcgcatgttcaaactcataaagcggatggtagcgatcgc
ggtaagttcataacgccaacgctgcgagagctcagtcaaactgcgccgtatatgcacaat
ggcatgcttgccacgcttgaagatgtggttgaattttataatcaaggtggtggcgaagac
tcaaacaaagactctcgactcaccacactttccctaacggactatgaaaaaaaggcgctg
gtggcttttttggaatcgttatctggagacgcccttataggcgaagaatacgaatggtta
gactatgacttcggctacgaatacacggaggattggtcaaatgctcgtaactaa

DBGET integrated database retrieval system