KEGG   Vibrio splendidus: VS_II0759Help
Entry
VS_II0759         CDS       T00812                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vsp  Vibrio splendidus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vsp00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VS_II0759
Enzymes [BR:vsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VS_II0759
   3.1.2  Thioester hydrolases
    3.1.2.-  
     VS_II0759
Lipid biosynthesis proteins [BR:vsp01004]
 Fatty acid synthase
  Component type
   VS_II0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:828027..828644
Genome map
AA seq 205 aa AA seqDB search
MTRLISFLFLIIFSTASLAQDTELDSKLLVLGDSLSAGYNMDIKQSWPSLLPDALAKHDK
TVTVVNGSISGDTTGNGLARLPQLLEEHAPDTVLIELGANDGLRGFPPKLMSANLDQIIK
QIKAAGAKPIMMKIKIPPNYGKRYNQQFEYVFAALADQQSVPLLPFFLEHIILKPEWMMN
DGLHPKPEAQPWIAEFVAKELYQYL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgactcgactaatttcctttttattcttaattatattttcaaccgcttctttggctcaa
gataccgagttagattctaagttactggtgcttggtgatagcttgagtgctggttataac
atggacatcaaacagagttggccaagcctgttaccagacgcgttagcaaagcatgacaaa
acggtaaccgtggtcaacggaagtatttctggtgacacaactggcaatggcttagctcgt
ttaccacaactgcttgaagaacacgccccagacactgttcttatcgaactcggtgcgaat
gatggtcttcgtgggttcccacctaagctgatgtctgcgaatcttgatcaaatcattaag
cagataaaagctgcgggcgcgaaacctattatgatgaagattaaaatcccaccgaattac
ggtaagcgttacaaccagcagtttgaatacgtctttgcagcgcttgctgatcaacaaagc
gtgccacttttgccgttttttctagagcatatcatcctcaaacctgagtggatgatgaac
gatggactgcatccaaaaccagaagctcagccttggattgctgaatttgtcgccaaagaa
ttatatcagtatctttag

DBGET integrated database retrieval system