KEGG   Vibrio tubiashii: IX91_17095Help
Entry
IX91_17095        CDS       T03445                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vtu  Vibrio tubiashii
Pathway
vtu00071  Fatty acid degradation
vtu00072  Synthesis and degradation of ketone bodies
vtu00280  Valine, leucine and isoleucine degradation
vtu00310  Lysine degradation
vtu00362  Benzoate degradation
vtu00380  Tryptophan metabolism
vtu00620  Pyruvate metabolism
vtu00630  Glyoxylate and dicarboxylate metabolism
vtu00640  Propanoate metabolism
vtu00650  Butanoate metabolism
vtu00900  Terpenoid backbone biosynthesis
vtu01100  Metabolic pathways
vtu01110  Biosynthesis of secondary metabolites
vtu01120  Microbial metabolism in diverse environments
vtu01130  Biosynthesis of antibiotics
vtu01200  Carbon metabolism
vtu01212  Fatty acid metabolism
vtu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vtu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IX91_17095
   00630 Glyoxylate and dicarboxylate metabolism
    IX91_17095
   00640 Propanoate metabolism
    IX91_17095
   00650 Butanoate metabolism
    IX91_17095
  Lipid metabolism
   00071 Fatty acid degradation
    IX91_17095
   00072 Synthesis and degradation of ketone bodies
    IX91_17095
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IX91_17095
   00310 Lysine degradation
    IX91_17095
   00380 Tryptophan metabolism
    IX91_17095
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IX91_17095
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IX91_17095
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    IX91_17095
Enzymes [BR:vtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IX91_17095
Exosome [BR:vtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IX91_17095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIW15816
UniProt: F9T8M4
Position
2:355755..356966
Genome map
AA seq 403 aa AA seqDB search
MTEKVYIVAAKRTPIGSFLGGLSSQSAVELASLTIRSALAQAELAPTMIDEVVVGNVLGA
GLGQGVGRQAAIHAEIPVTTPAYTLNMICGSGMKSILNAINSVRSGDANLVVAAGTESMS
NAPFVMDGKCRQGNKMGDISMIDTMLKDGLTDAFGSFHMGITAENIAKRYEISRGEQDAF
ALRSQSRAEQAIKSGCFEQEIVPVVIKSRKGESAVNLDEHPRFGTTIESLSGLRAAFDKQ
GSVTAGNASGLNDGAVALIVASEQAVQQHGLAPLVEVVATGQGGVEPDVMGLGPIPAVKQ
ALQRAELELSDIQRLELNEAFASQAIGVMKGLSEQHQVPYDWFEGKTNVNGGAIALGHPI
GASGGRIVTTLIYEMIRSKTQLGLASLCIGGGMGTALILKRVS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaaagtctatattgttgctgccaagaggactccgattggcagcttccttggc
gggctgagctcccaatctgccgttgaattagcgagcttaaccattaggagtgcgcttgcc
caagccgaacttgccccgaccatgattgatgaagtggtagtgggtaatgtgctcggtgca
ggtctggggcagggggtgggtcggcaagccgctattcacgcagagatacctgtcacaacc
cctgcttataccttgaacatgatctgcggcagtggcatgaaatctatcctcaacgccata
aactcggtacgaagcggtgacgcaaaccttgtggttgctgcaggcaccgaaagtatgagt
aatgctcctttcgtgatggatgggaaatgtcgccaaggcaataaaatgggcgatatctcc
atgattgataccatgctcaaagatggcttaacggatgcttttggcagttttcatatgggt
attactgctgaaaacattgccaagcgctatgagataagccgtggagagcaagacgcattt
gccctgcgtagccaatcaagagccgagcaagcaattaagtctggttgctttgaacaagaa
atcgttcctgtcgtgattaaatcacgcaaaggtgaaagcgctgtgaatcttgatgagcat
ccgagattcggtacgaccatagaaagcctgtctgggcttcgagcggcattcgataagcaa
gggagtgtaacggcaggcaatgcctctggcttaaatgatggcgcggtagccttgattgtt
gccagtgagcaagcggttcagcaacatgggcttgctcctctggttgaggtagtcgcaaca
gggcagggtggtgttgagcctgatgtgatgggattaggcccaatcccggcggtaaaacag
gcattgcaacgcgcagagctcgagctgagtgatattcaaaggttagagctcaacgaagcc
ttcgcttcgcaagccattggagtgatgaaagggctgtctgaacagcatcaagtgccttac
gattggtttgaaggtaaaaccaacgtcaatggcggtgcgatagcccttgggcatccaatc
ggagcatcgggtggccgaattgtcactacgctgatctatgaaatgatccgctctaaaact
caactcggtctcgcctcactgtgtatcggtggtggtatgggtactgcgttgattctcaag
cgggttagttaa

DBGET integrated database retrieval system