KEGG   Vitis vinifera (wine grape): 100232843Help
Entry
100232843         CDS       T01084                                 

Gene name
CHS
Definition
chalcone synthase (EC:2.3.1.74)
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100232843 (CHS)
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    100232843 (CHS)
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     100232843 (CHS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 454 aa AA seqDB search
MVSVGEIRKSQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMC
DKSMINKRYMHLNEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP
KSKITHLVFCTTSGCDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAEN
NAGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPDTKIERPLFELV
SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPIGISDWNSLFW
IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGT
TGEGLEWGVLFGFGPGLTVETVVVAQPCYTIDSLSHSSTYNTEGKMGMAAALGTGEDCMS
SCANLRSYPSFLCYVLLYFYVLLCPCAFSPFTLK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcagtgggggaaatcagaaagtcccaaagagctgagggtccagccacggttctg
gccatcggcacggccactccagccaactgtgtctaccaggctgactatcctgattactac
ttccgcatcaccaacagcgagcatatgactgaattgaaagagaagttcaagcgcatgtgt
gataaatccatgataaacaaacgctacatgcacctcaatgaagaaattctcaaggagaac
cccaacgtctgtgcctacatggccccatctcttgatgcccgtcaagacatggtggtggtt
gaagtaccaaagctcggcaaggaagctgctgtcaaggccatcaaagaatggggccagccc
aaatccaagatcacccaccttgttttctgcaccacttccggttgtgacatgcccggtgct
gactatcaactcaccaagctgctcggcctcaaaccttccgtcaagaggctgatgatgtac
caacagggctgctttgctggaggcaccgtcctccgccttgccaaggatcttgccgagaac
aacgccggcgcccgtgttttggtcgtctgctctgaaatcaccgccgtcactttccgaggc
ccctctgacacccacctggattctctcgtgggtcaggcgcttttcggtgatggtgcagct
gccattatcattggtgcagacccagataccaaaatcgaacgcccactcttcgaactcgtc
tctgcggctcagactattctccccgactccgagggtgcaatcgatggacacctgcgcgaa
gtgggtctcacgttccatttactgaaagacgtcccagggttgatttccaagaacatagag
aagagcttggtggaagcctttaagccgatcggcatcagcgactggaactccttgttctgg
atcgctcaccccggtggcccagcaattttagatcaggttgagttaaaactgggtctgaag
gaagagaaactgagagcaactcgacacgttctgagcgagtatgggaacatgtctagtgca
tgcgtgctgtttatcctggacgaaatgaggaaaaagtcgatcgaagaaggaaagggcacc
acaggggaaggcctggaatggggcgttctgtttggatttggaccaggtctcaccgttgaa
accgttgttgttgcacagccttgctacacaatcgactcactgagtcactcgtcaacctat
aatactgaagggaagatgggaatggctgctgcgctggggactggtgaggactgcatgtca
tcatgtgccaacctacgcagctacccttccttcctttgttatgttttgctttatttttat
gttcttttgtgtccctgtgccttctctcctttcacacttaagtaa

DBGET integrated database retrieval system