KEGG   Vitis vinifera (wine grape): 100232843Help
Entry
100232843         CDS       T01084                                 

Gene name
CHS, CHS2
Definition
(RefSeq) chalcone synthase
  KO
K00660  chalcone synthase [EC:2.3.1.74]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00941  Flavonoid biosynthesis
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
vvi04712  Circadian rhythm - plant
Module
vvi_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100232843 (CHS)
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    100232843 (CHS)
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     100232843 (CHS)
Polyketide biosynthesis proteins [BR:vvi01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    100232843 (CHS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III_C ACP_syn_III FAE1_CUT1_RppA
Motif
Other DBs
NCBI-GeneID: 100232843
NCBI-ProteinID: NP_001268064
UniProt: O22519
Position
14
AA seq 454 aa AA seqDB search
MVSVGEIRKSQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMC
DKSMINKRYMHLNEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQP
KSKITHLVFCTTSGCDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAEN
NAGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPDTKIERPLFELV
SAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPIGISDWNSLFW
IAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGT
TGEGLEWGVLFGFGPGLTVETVVVAQPCYTIDSLSHSSTYNTEGKMGMAAALGTGEDCMS
SCANLRSYPSFLCYVLLYFYVLLCPCAFSPFTLK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcagtgggggaaatcagaaagtcccaaagagctgagggtccagccacggttctg
gccatcggcacggccactccagccaactgtgtctaccaggctgactatcctgattactac
ttccgcatcaccaacagcgagcatatgactgaattgaaagagaagttcaagcgcatgtgt
gataaatccatgataaacaaacgctacatgcacctcaatgaagaaattctcaaggagaac
cccaacgtctgtgcctacatggccccatctcttgatgcccgtcaagacatggtggtggtt
gaagtaccaaagctcggcaaggaagctgctgtcaaggccatcaaagaatggggccagccc
aaatccaagatcacccaccttgttttctgcaccacttccggttgtgacatgcccggtgct
gactatcaactcaccaagctgctcggcctcaaaccttccgtcaagaggctgatgatgtac
caacagggctgctttgctggaggcaccgtcctccgccttgccaaggatcttgccgagaac
aacgccggcgcccgtgttttggtcgtctgctctgaaatcaccgccgtcactttccgaggc
ccctctgacacccacctggattctctcgtgggtcaggcgcttttcggtgatggtgcagct
gccattatcattggtgcagacccagataccaaaatcgaacgcccactcttcgaactcgtc
tctgcggctcagactattctccccgactccgagggtgcaatcgatggacacctgcgcgaa
gtgggtctcacgttccatttactgaaagacgtcccagggttgatttccaagaacatagag
aagagcttggtggaagcctttaagccgatcggcatcagcgactggaactccttgttctgg
atcgctcaccccggtggcccagcaattttagatcaggttgagttaaaactgggtctgaag
gaagagaaactgagagcaactcgacacgttctgagcgagtatgggaacatgtctagtgca
tgcgtgctgtttatcctggacgaaatgaggaaaaagtcgatcgaagaaggaaagggcacc
acaggggaaggcctggaatggggcgttctgtttggatttggaccaggtctcaccgttgaa
accgttgttgttgcacagccttgctacacaatcgactcactgagtcactcgtcaacctat
aatactgaagggaagatgggaatggctgctgcgctggggactggtgaggactgcatgtca
tcatgtgccaacctacgcagctacccttccttcctttgttatgttttgctttatttttat
gttcttttgtgtccctgtgccttctctcctttcacacttaagtaa

DBGET integrated database retrieval system