KEGG   Vitis vinifera (wine grape): 100232854Help
Entry
100232854         CDS       T01084                                 

Gene name
ADH2
Definition
alcohol dehydrogenase 2 (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:vvi01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vvi00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:vvi00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:vvi00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 380 aa AA seqDB search
MSSTAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQVMEVRLKILFTSLCHTDVYFWEAKGQ
TPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECRHCKSEESNMCDLLRIN
TDRGVMLSDNKSRFSINGKPVYHFVGTSTFSEYTVIHVGCVAKINPAAPLDKVCVLSCGI
STGLGATLNVAKPSKGSSIAIFGLGAVGLAAAEGARIAGAARIIGIDLNPKRFNDAKKFG
VTEFLNPKDHDKPIQEVIAEMTDGGVDRSVECTGNVNAMISAFECVHDGWGVAVLVGVPN
KDDSFKTHPVNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHEVPFAEIN
KAFEYMLSGDGLRCIIRMDA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcacagctggtcaggttatacgctgcaaagccgcggtggcatgggaagcggga
aagccgttggtgatcgaagaagtggaagtggcgcctccacaggtcatggaggtccgtctg
aagatcctcttcacttctctctgccacaccgatgtttacttctgggaagccaagggacaa
acccctttatttcctcgcatatttggtcatgaggcaggcgggattgtggagagcgtgggt
gagggtgtcacagatctccaacctggagaccatgttcttcctgtattcaccggagaatgc
aaggagtgccggcattgcaagtcggaggagagtaacatgtgtgacctcctcaggattaac
accgacagaggcgtgatgctcagtgataacaagtcaagattctctattaatggaaaaccc
gtttaccattttgtggggacttccacatttagtgaatacactgtgatccatgttggttgc
gttgccaagatcaaccccgctgccccactcgacaaagtttgtgttcttagctgtggaatc
tctacaggtcttggtgctaccttgaatgttgccaaaccatcgaagggttcatcaatcgcc
attttcggtttaggagcagtggggcttgctgctgctgagggagctagaattgcaggtgct
gccagaattattgggattgatctaaaccctaagagatttaatgacgcaaagaaatttggc
gtcactgagtttttgaacccaaaggatcatgacaagcctattcaagaggtgattgctgag
atgaccgatgggggagtggacagaagcgttgagtgtaccggaaatgtcaatgctatgatt
tctgcatttgagtgtgttcatgatgggtggggtgttgctgtactggttggtgtgccaaac
aaagacgactcattcaaaacgcatcccgtgaatctattgaacgagaggactctgaagggc
actttctttggcaactacaaaccccgttccgaccttccttcagtggtggaaaaatacatg
aacaaggagcttgaagtggagaaattcatcacacatgaagtcccttttgcagagatcaac
aaggccttcgaatatatgctgagcggggatgggcttcgatgcatcattcgcatggatgca
taa

DBGET integrated database retrieval system