KEGG   Vitis vinifera (wine grape): 100232854Help
Entry
100232854         CDS       T01084                                 

Gene name
ADH2, ADH6
Definition
(RefSeq) alcohol dehydrogenase 2
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00010  Glycolysis / Gluconeogenesis
vvi00071  Fatty acid degradation
vvi00350  Tyrosine metabolism
vvi00592  alpha-Linolenic acid metabolism
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100232854 (ADH2)
  Lipid metabolism
   00071 Fatty acid degradation
    100232854 (ADH2)
   00592 alpha-Linolenic acid metabolism
    100232854 (ADH2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100232854 (ADH2)
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100232854 (ADH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C TrkA_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 100232854
NCBI-ProteinID: NP_001268083
UniProt: Q9FZ01
Position
4
AA seq 380 aa AA seqDB search
MSSTAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQVMEVRLKILFTSLCHTDVYFWEAKGQ
TPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECRHCKSEESNMCDLLRIN
TDRGVMLSDNKSRFSINGKPVYHFVGTSTFSEYTVIHVGCVAKINPAAPLDKVCVLSCGI
STGLGATLNVAKPSKGSSIAIFGLGAVGLAAAEGARIAGAARIIGIDLNPKRFNDAKKFG
VTEFLNPKDHDKPIQEVIAEMTDGGVDRSVECTGNVNAMISAFECVHDGWGVAVLVGVPN
KDDSFKTHPVNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHEVPFAEIN
KAFEYMLSGDGLRCIIRMDA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcacagctggtcaggttatacgctgcaaagccgcggtggcatgggaagcggga
aagccgttggtgatcgaagaagtggaagtggcgcctccacaggtcatggaggtccgtctg
aagatcctcttcacttctctctgccacaccgatgtttacttctgggaagccaagggacaa
acccctttatttcctcgcatatttggtcatgaggcaggcgggattgtggagagcgtgggt
gagggtgtcacagatctccaacctggagaccatgttcttcctgtattcaccggagaatgc
aaggagtgccggcattgcaagtcggaggagagtaacatgtgtgacctcctcaggattaac
accgacagaggcgtgatgctcagtgataacaagtcaagattctctattaatggaaaaccc
gtttaccattttgtggggacttccacatttagtgaatacactgtgatccatgttggttgc
gttgccaagatcaaccccgctgccccactcgacaaagtttgtgttcttagctgtggaatc
tctacaggtcttggtgctaccttgaatgttgccaaaccatcgaagggttcatcaatcgcc
attttcggtttaggagcagtggggcttgctgctgctgagggagctagaattgcaggtgct
gccagaattattgggattgatctaaaccctaagagatttaatgacgcaaagaaatttggc
gtcactgagtttttgaacccaaaggatcatgacaagcctattcaagaggtgattgctgag
atgaccgatgggggagtggacagaagcgttgagtgtaccggaaatgtcaatgctatgatt
tctgcatttgagtgtgttcatgatgggtggggtgttgctgtactggttggtgtgccaaac
aaagacgactcattcaaaacgcatcccgtgaatctattgaacgagaggactctgaagggc
actttctttggcaactacaaaccccgttccgaccttccttcagtggtggaaaaatacatg
aacaaggagcttgaagtggagaaattcatcacacatgaagtcccttttgcagagatcaac
aaggccttcgaatatatgctgagcggggatgggcttcgatgcatcattcgcatggatgca
taa

DBGET integrated database retrieval system