KEGG   Vitis vinifera (wine grape): 100232881Help
Entry
100232881         CDS       T01084                                 

Gene name
P5CS
Definition
pyrroline-5-carboxylate synthetase
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100232881 (P5CS)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100232881 (P5CS)
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     100232881 (P5CS)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     100232881 (P5CS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 762 aa AA seqDB search
MHMDAMDPTRAFVKDVKRLVIKFGTAVVTRSDGRLALGRLGALCEQIKELNSQGYQVIVV
TSGAVGLGRQRLRYRSLLNSSFADLQKPQAELDGKACAAVGQNNLMALYDTLFSQLDVTS
AQLLVTDNDFRDEAFRNQLTQTVDSLLALRVIPIFNENDAEVTRKAPYEDSSGIFWDNDS
LAGLLALQLKADLLVLLSDVDGLYSGPPSDPRSLLIHTYLEKGHQGQITFGDKSRVGRGG
MTAKVKSAVYSSQAGIPVVITSGYATGSILKVLNGERIGTLFHRDAYKWVQVKEVGAREM
AVAARESSRRLQAMSSQDRKKILLDIANALETNEELIKIENDADVEAAQLAGYEKSLVSR
LVLKPGKISSLANSIRVLANMERPIGHVLKKTEVADGLILEKMSCPLGVLLIVFESRPNA
LVQIASLAIRSGNGLLLKGGKEAKRSNAILAKVITEAIPDSVGKKLIGLVTSREEIPNLL
KLDDVIDLVIPRGSNKLVSQIKDSTKIPVLGHADGICHVYVDKSANMDTAKHIVLDAKVD
YPAACNAMETLLVHKDLVQTGGLNQLIVELRNEGVTLYGGPKASALLNLPEAHSFHHEYN
SMACTVEIVDDVHSAIDHIHRHGSAHDCIIAEDLEVAEVFLRQVDSAAVFHNASTRFCDG
ARFGLGAGGWISTSRIHARGPVGVEGLLTTRWILRGNGQVVNGDKGVTYLHPQGAYFAAL
SLSHSLLGGDLLNNVGLGTFDFSFCNGRRVNWTLDLKEVIYQ
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgcacatggacgccatggatccaactcgagcttttgttaaggacgttaagcgtctcgta
atcaagtttgggactgctgttgtcactcggtctgatggaagattagcactcggaagacta
ggtgcactttgtgagcagatcaaagaattgaactctcaaggatatcaggtcattgtggtc
acatcaggtgctgttggccttggtcgccaaaggcttagatacaggagtttactcaacagc
agctttgctgatctccaaaaaccacaagctgagcttgatggtaaggcgtgtgcagctgtt
ggacaaaataaccttatggctctctatgacacattatttagccagctggatgtgacatca
gctcagcttcttgtgactgataatgattttagggatgaagctttccgaaatcaacttact
caaacagtggattcattgttagctttgagggttattcctatatttaatgaaaatgatgct
gaagtaacaaggaaagctccatatgaggattcttcgggaatattttgggataatgacagt
ttagcaggcctactggctttgcagctaaaggctgacctccttgttctattgagcgatgta
gatggtctttatagtggccctcctagtgatccacgttctttactaatccatacatacttg
gaaaaaggtcatcagggacagattacttttggagacaagtcgagggttggaagagggggt
atgactgcgaaagtaaaatctgcagtttattcatctcaggctggcattcctgttgttatt
actagtgggtatgctactggaagtatcttaaaggtccttaatggggagcgtattggcact
ctttttcatcgagatgcctataaatgggtacaagttaaagaagttggcgcacgtgaaatg
gcagttgcagcaagggaaagttccaggcggcttcaggcaatgtcttcacaagacaggaag
aagattttactggacatagccaatgcactggaaacaaatgaagaactgattaaaattgaa
aatgatgctgatgttgaggcagcacaactggctggatatgaaaaatcattggtttcaagg
ctggttctaaagcctggaaagatttcaagccttgcaaactcaattcgtgtgcttgcaaac
atggaaagaccaattggtcatgttttgaagaaaactgaagttgcagatggacttatccta
gaaaagatgtcatgcccattaggtgtgctcctaattgtttttgagtctcgaccaaatgct
ctggtacagatagcttcattagcaatccgaagtgggaatggacttctcttgaaaggtgga
aaagaggccaagcgatctaatgcaattcttgcaaaggttattactgaagccattccagac
agtgttgggaagaagctaattggacttgtgacttcaagagaggagatccctaatctcctc
aagcttgatgatgtgatcgaccttgtaatcccaagaggcagcaataaacttgtttctcaa
ataaaggattcaacaaaaattcctgttctgggccatgctgatggcatctgccacgtttat
gtcgacaagtctgctaatatggatactgcaaagcacatcgtattggatgcaaaagtagat
tatcctgcagcctgtaatgcaatggaaacacttcttgtacacaaggatttagtgcagact
ggtggcctcaatcagcttatcgtagagctccgcaatgaaggggttactttatatggtgga
ccaaaggcaagtgccttgctgaatcttccagaggctcactcttttcatcatgagtataat
tcaatggcttgcactgttgagattgttgatgatgtacattctgccattgatcatattcac
cgacatggaagtgcacacgattgcatcattgcagaagaccttgaagttgctgaagtgttt
ttgcgccaagttgatagtgctgctgtctttcacaatgctagcacaagattttgtgatggg
gctcgttttggacttggggccggaggttggataagtacaagtaggattcatgctcgaggt
ccagtcggagttgaaggattgttaacaacaagatggattctcagaggaaatggccaagtg
gtgaatggcgataaaggggttacttacttacacccacaaggagcttactttgcagcccta
agcctatcccatagtttgcttggtggcgatttattgaataatgtaggattgggtactttt
gatttcagtttttgtaacggtagaagggtcaactggaccttggaccttaaagaggtaatt
tatcaataa

DBGET integrated database retrieval system