KEGG   Vitis vinifera (wine grape): 100232988Help
Entry
100232988         CDS       T01084                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vvi00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:vvi00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 309 aa AA seqDB search
MASDKIDGFTLEQRHGKARVRLGRVWRSQSGRHIFVEWTVSISLLSNCLAAYVRDDNSDI
VATDSMKNTVYAKAKECAQQLSMEEFAIKLAKHFTSFYQQVTTAIVTVEEKPWERAYIDG
QPHDHGFKRGSETHTTEVIVEKSGALQVTSGIQGLALLKTTQAGFEGFIRDKYTALADTR
ERIVATEVTASWRYPFESLSGIPLQPLYFTEKYLDVKKVLAETFFGPPRGGVYSPSVQST
LYQMAKNVLNRFPDISSIQLKMPNLHFLPVNISSKDNPAIVKFDDDVYLPTSEPHGSIEA
TVSRIRAKI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgataaaatagatggatttacgttggagcaaaggcatggcaaagcgcgagtg
aggttgggtagggtttggcgaagccaaagcggccgtcatatcttcgtcgaatggaccgtc
agcatcagcctcctctccaactgcctcgccgcctacgtccgcgacgacaactccgacatc
gtcgccaccgattccatgaaaaacactgtttatgcaaaagcaaaggaatgtgctcaacaa
ctttcaatggaggagtttgcaattaaacttgccaagcactttacatcattttatcagcag
gttaccactgccatagtcacagtagaggaaaagccatgggagcgtgcatatatagatggt
caaccacatgatcatggatttaaacgtggatctgagacgcatacaacagaagtaatagtg
gagaaatctggagctttacaagtgacttctggtattcaaggcttggctttgttgaagaca
acccaggcaggttttgaagggtttattagggacaaatacactgctctggctgacacacga
gaaaggatagtcgcaacagaggtcactgcatcttggaggtatccttttgaatctctctct
ggcatccccttgcagccattgtactttacagagaagtacctggacgtgaaaaaggttctg
gctgaaaccttttttggccctccaagagggggagtatacagcccatctgttcaaagcact
ctttaccaaatggcaaagaatgtgctcaacaggttccctgatatctcatcaatccaatta
aaaatgccaaatctccacttcttgccagttaatatatcaagcaaagataatccagctatt
gtgaagtttgatgatgatgtgtacttaccaacaagcgagccacatggatcgattgaagcg
acggtgagccgcatcagggcaaagatctag

DBGET integrated database retrieval system