KEGG   Vitis vinifera (wine grape): 100232988Help
Entry
100232988         CDS       T01084                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100232988
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100232988
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     100232988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 309 aa AA seqDB search
MASDKIDGFTLEQRHGKARVRLGRVWRSQSGRHIFVEWTVSISLLSNCLAAYVRDDNSDI
VATDSMKNTVYAKAKECAQQLSMEEFAIKLAKHFTSFYQQVTTAIVTVEEKPWERAYIDG
QPHDHGFKRGSETHTTEVIVEKSGALQVTSGIQGLALLKTTQAGFEGFIRDKYTALADTR
ERIVATEVTASWRYPFESLSGIPLQPLYFTEKYLDVKKVLAETFFGPPRGGVYSPSVQST
LYQMAKNVLNRFPDISSIQLKMPNLHFLPVNISSKDNPAIVKFDDDVYLPTSEPHGSIEA
TVSRIRAKI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgataaaatagatggatttacgttggagcaaaggcatggcaaagcgcgagtg
aggttgggtagggtttggcgaagccaaagcggccgtcatatcttcgtcgaatggaccgtc
agcatcagcctcctctccaactgcctcgccgcctacgtccgcgacgacaactccgacatc
gtcgccaccgattccatgaaaaacactgtttatgcaaaagcaaaggaatgtgctcaacaa
ctttcaatggaggagtttgcaattaaacttgccaagcactttacatcattttatcagcag
gttaccactgccatagtcacagtagaggaaaagccatgggagcgtgcatatatagatggt
caaccacatgatcatggatttaaacgtggatctgagacgcatacaacagaagtaatagtg
gagaaatctggagctttacaagtgacttctggtattcaaggcttggctttgttgaagaca
acccaggcaggttttgaagggtttattagggacaaatacactgctctggctgacacacga
gaaaggatagtcgcaacagaggtcactgcatcttggaggtatccttttgaatctctctct
ggcatccccttgcagccattgtactttacagagaagtacctggacgtgaaaaaggttctg
gctgaaaccttttttggccctccaagagggggagtatacagcccatctgttcaaagcact
ctttaccaaatggcaaagaatgtgctcaacaggttccctgatatctcatcaatccaatta
aaaatgccaaatctccacttcttgccagttaatatatcaagcaaagataatccagctatt
gtgaagtttgatgatgatgtgtacttaccaacaagcgagccacatggatcgattgaagcg
acggtgagccgcatcagggcaaagatctag

DBGET integrated database retrieval system