KEGG   Vitis vinifera (wine grape): 100233078Help
Entry
100233078         CDS       T01084                                 

Gene name
CHI, CHI1, CHI2
Definition
chalcone isomerase (EC:5.5.1.6)
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100233078 (CHI)
Enzymes [BR:vvi01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     100233078 (CHI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 234 aa AA seqDB search
MSQVPSVTAVQVENVLFPPSVKPPGSTNDLFLGGAGVRGLEIQGKFVKFTAIGVYLENSA
VPTLAVKWKGKTVEELADSVDFFRDVVTGPFEKFTKVTTILPLTGRQYSDKVSENCVAFW
KSVGIYTDAEAKAIEKFNEVLKDETFPPGNSILFTHSPLGALTMSFSKDGSLPEVGNAVI
ENKLLTEAVLESIIGKHGVSPEAKKSLAARLSELFCKEAGDEKIEAEKVAPVAC
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagtgccgtcagtcaccgcagttcaggtcgagaacgtcctatttccgccgtcg
gtgaagccgccgggctccaccaacgacctcttcctcggcggtgcaggggtgagaggtttg
gagatccaagggaagttcgtgaagttcacagccatcggagtgtacttggagaacagcgcc
gttcctacgctcgccgtcaagtggaagggcaagactgtggaggagttagcggattcggtt
gactttttccgagatgtcgtcacaggcccctttgagaaattcacaaaggtaacaacgatt
ttgcctttgacgggtcgccagtattcagacaaggtgtcagagaattgtgttgccttttgg
aaatctgttggaatttacactgacgcagaagccaaagccattgagaaattcaatgaggtc
ttgaaggatgaaaccttcccaccaggcaactccattcttttcactcattctccccttgga
gctttaacgatgagcttctccaaagatgggtccctaccagaagttgggaatgcagtgata
gagaataaattattgacggaggcggtactggagtccatcatcggcaagcatggtgtttcc
cctgaagcgaagaagagtttggcagcaagattatcggaattattctgcaaggaggctggg
gatgagaaaattgaagctgagaaggttgctccggtggcttgttaa

DBGET integrated database retrieval system