KEGG   Vitis vinifera (wine grape): 100233142Help
Entry
100233142         CDS       T01084                                 

Gene name
LDOX, ANS
Definition
leucoanthocyanidin dioxygenase (EC:1.14.11.19)
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100233142 (LDOX)
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     100233142 (LDOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 355 aa AA seqDB search
MVTSVAPRVESLSSSGIQSIPKEYIRPQEELTSIGNVFEEEKKDEGPQVPTIDLKDIESE
DEVVRERCREELKKAAMEWGVMHLVNHGISDDLINRVKVAGETFFNLPMEEKEKYANDQA
SGKIAGYGSKLANNASGQLEWEDYFFHLIFPEDKRDMTIWPKTPSDYVPATCEYSVKLRS
LATKILSVLSLGLGLEEGRLEKEVGGMEELLLQKKINYYPKCPQPELALGVEAHTDVSAL
TFILHNMVPGLQLFYEGKWVTAKCVPNSIIMHIGDTIEILSNGKYKSILHRGLVNKEKVR
ISWAVFCEPPKEKIILKPLPETVSETEPPLFPPRTFSQHIQHKLFRKTQEALLSK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggtgacttcagtggctcctagagttgagagcttgtccagcagtgggatccagtcaatc
cccaaagagtacatccgcccccaagaagagctcaccagcattggcaatgtctttgaggag
gagaagaaggatgaagggcctcaggttccaactattgacttgaaggatattgagtctgag
gacgaggtggtccgggagagatgccgggaggagttgaagaaagctgccatggagtggggt
gtgatgcaccttgttaaccatggcatctctgatgaccttatcaaccgtgttaaggttgct
ggagagacctttttcaatctccccatggaggaaaaggagaagtatgctaatgaccaggcc
tccggcaagatcgctggctatggcagcaagcttgccaacaatgctagtggacagcttgag
tgggaggactacttcttccacctcatcttccctgaggacaagcgcgatatgaccatctgg
cctaagacaccaagcgactacgttccagcaacctgtgagtactcggtgaaacttaggagc
ctggcaaccaagatactatcggtgctatcgcttgggttgggattggaagaagggagacta
gaaaaggaagttggtgggatggaagagctactactccaaaagaagatcaactactacccc
aagtgtccccagcctgaattggctctcggggtggaagctcacactgacgtgagcgctctc
accttcatcctccacaacatggtacccggcctgcaacttttctatgagggcaagtgggtg
acagccaagtgtgtccccaactccatcatcatgcacattggagacaccatagagattctc
agcaatggtaagtacaagagtattcttcacaggggactggtcaacaaggagaaggtgagg
atttcatgggcagttttctgcgagccgcctaaggagaagatcatcctgaagccactgcca
gagacggtgtctgagactgagccaccactcttcccacctcgcaccttttcccaacatatt
cagcacaagctcttcaggaagacccaggaggctctactctccaaatga

DBGET integrated database retrieval system