KEGG   Vitis vinifera (wine grape): 100240775Help
Entry
100240775         CDS       T01084                                 

Definition
uncharacterized LOC100240775
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100240775
Protein kinases [BR:vvi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100240775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 957 aa AA seqDB search
MDDDGVGASKDAQPQHSDQATSSSSSSAESESRWRPSKLVFAPYSPSLEAATKSQALRVV
VRRPLVARLTKDIVETYQICNPQFKYSEELNPKRFLTSPSIGVLNDGHDNVNSDLILAVN
SVLVNSETQRRYIIKDILGHGTFGQVAKCWVTETNSFTAVKIIKNQPAYYQQALVEVSIL
TTLNKKYDPEDKNHIVRIYDYFVHQRHLCIAFELLDTNLYELIKINHFRGLSLSIVQLFS
KQILRGLALMKDAGIIHCDLKPENILLCTRVKPAEIKIIDFGSACMEDRTVYSYIQSRYY
RSPEVLLGYQYTTAIDMWSFGCIVAELFLGLPLFPGASEFDLLRRMIQILGGQPPDYVLK
EAKNTSKFFKCIGSFHHVENGDVSMGGRSAYLALSEEDYEARELKKPSIGKEYFIHKNLE
AIVTNYPYRKNLAEEDIVKESRVRLALIDFLRGLVEFDPAKRWSPFQASKHPFVTGEPFT
CPYRPPAETPRVPVAQNVKVDHHPGGGHWFAAGLSPNIPGRNRATLHNSPHFQVVPYAHA
SSYGSLGSHGSYNDGTGLGSSYGSYGDNSNMFAYYSPAGPSAMNIHAQGGVSMLGTSPDA
RRRIIPFPHGNGLGVSPSAGNFAPLPLGTSPSQFTPPNSYSQVSTGSPGHYGPTSPARGS
CHGSPLGKMAAVSQFNRRKSWGYSGSLQSQESSSSAHWQGHFTDGTSSNQSEGNSQAFGG
SPLHLQSNSNATSWKQQRGGSGIAFQNIPSSFTLGSNVQFAQTAGVVHEKPESSLLLPDP
GDWDPNYSDELLLQDDGSDMATEFSKGMHLGQNFGSAEPLVGVGRFGHASSTSSNTSRPI
QPFSHAEVGSPPTHDPHAGYVRPMSKPSHFVPHISQNSPSRLGQQPIQRLNHGRSTAGRG
SDWSQTKPSPPNFSSGGPRSPGNSSFSNGMSWGRRANHPVTNLPPTSYGRKDYGRIA
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatggggtgggtgctagtaaggatgcccaacctcagcactctgatcaggca
acctcgtcgtcgtcgtcctccgccgaatcggaatcgagatggcgcccaagcaagctcgtg
ttcgctccttattcgccttcccttgaagctgctaccaagtctcaagctctgcgagtggtt
gtgagaaggcctttggtggcaaggctaaccaaggacatagttgaaacataccagatatgt
aatccacagttcaagtattcagaagaattgaatccaaagcgattcttgaccagtccatcg
attggtgttttaaatgatggccatgataatgtgaattcggatcttatactggctgtcaac
tcagtcttggtcaattcagaaacacagagaagatacatcatcaaagatattcttggccat
gggacatttgggcaggttgctaaatgctgggttacagaaactaacagtttcactgctgtt
aaaattattaaaaatcaacctgcatactatcaacaagccctggttgaagtctctattctg
actacattaaataagaagtatgatcccgaggataagaatcacattgttcgtatctatgat
tactttgttcatcagcgtcatttgtgcattgcttttgagttgcttgacacaaatctgtat
gagcttatcaagataaaccattttcgggggctatcattgagcattgttcagttgttttca
aaacagatattgcgtggattggctttgatgaaagatgctggtattattcactgtgatctg
aagccagaaaatattctcctatgcacgagggtgaagccagcagaaatcaaaattatcgac
tttggatctgcctgtatggaagatcgaactgtttactcctacattcagagtcgatactat
aggtctcctgaagttcttctcggctatcagtatactacggctattgacatgtggtctttt
gggtgtatagttgctgagttgtttctagggttgccgctatttcccggagcttcagaattt
gatcttctaaggcgaatgatacaaatacttgggggacagccccctgactatgtactaaag
gaggcaaaaaacactagtaaattctttaagtgcattgggagtttccatcatgtagagaat
ggtgatgtttctatgggtggcagaagtgcttatctggccttgtcagaagaagattacgaa
gctagggagttgaaaaaaccgtcaattggaaaagagtatttcattcataagaaccttgaa
gcaattgttacaaactacccttacagaaagaacttggctgaggaagatattgtcaaagaa
agtcgagttcggttggcactgattgatttcttgaggggactggttgaatttgatcctgca
aagcggtggtcaccttttcaggcttcaaaacatccttttgtgacaggcgaacctttcaca
tgcccttacagacctcctgcagagactcctcgtgtgcctgttgctcaaaatgttaaggtg
gatcatcacccaggtggaggccattggtttgctgctggtctctctcctaacattccaggc
agaaatagagctaccctgcataacagcccacattttcaggttgtgccatatgcacatgcc
agtagttatggcagtttaggaagccatggtagttataatgatggtactgggcttggaagc
agctatggaagttatggagacaatagcaatatgtttgcatattattcacctgctggtccg
tctgcaatgaacatccatgcacagggtggtgtctcaatgcttggaacaagccctgatgcg
aggcggaggattattccattcccacatggaaatggacttggtgtaagtccatctgcagga
aattttgcaccattgcctcttggaaccagtccctcacaatttactcctccgaactcctat
agccaggtttcaactggttctcctggacactatgggccgacttctccagcaagaggcagt
tgtcatggatcacctttagggaaaatggctgcagttagccagttcaacagaagaaaaagt
tggggatattctggaagtttgcaatctcaagagagttcttcatctgcacattggcagggg
cattttactgatggtacgagctctaaccaatctgagggaaactctcaagcatttggtggc
tccccattgcatctgcaatcaaactctaatgccacaagctggaagcagcagcgaggtggc
agtggaattgctttccagaacattccaagttcctttacacttggttccaatgtacaattt
gcacaaactgcgggtgtggttcatgaaaaaccggaatctagccttttgctgcctgatcct
ggagattgggatcccaactatagtgatgaacttcttttgcaagacgatggttcggacatg
gccaccgagtttagcaaagggatgcatcttggtcaaaattttggttctgcagagccatta
gttggagttggaagattcggccatgcctcaagcacaagctcaaatacatccaggcccatt
caaccattttcgcatgcagaggtgggcagccctcctacccatgatccacatgctggatat
gtgcggcccatgtcaaagccttcacacttcgtgcctcatatatcacaaaattctcctagc
cgtttggggcaacaacccattcagcggttaaatcatgggagatcaacggctggtcgtggt
agtgactggagtcaaactaagcccagtcctcccaattttagctctgggggtccacgttct
cctgggaatagctcgttcagcaatggcatgtcatgggggcgtcgggccaatcatcctgtc
accaacttaccgccaacatcctatggaagaaaagactatggaaggattgcgtaa

DBGET integrated database retrieval system