KEGG   Vitis vinifera (wine grape): 100240836Help
Entry
100240836         CDS       T01084                                 

Definition
beta-hexosaminidase-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100240836
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100240836
   00603 Glycosphingolipid biosynthesis - globo series
    100240836
   00604 Glycosphingolipid biosynthesis - ganglio series
    100240836
   00511 Other glycan degradation
    100240836
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100240836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 576 aa AA seqDB search
MAVSDKALFSIVFLFTAFVSSISASESQSQINVWPKPRTFSWPSPQASLLSPNFSITSPN
HQHLSSAVARYLRLILTEHHHPLVTPTVNITGPPLETLTIIVSDLAAPLHHGVDESYTLI
VPRGGAANLTAATVWGAMRGLETFSQIVWGDPLRVATGLFVWDSPLFGHRGVMLDTSRNY
YGVEDILRTIGAMSANKLNVFHWHITDSHSFPLLLPSEPDLAGKGSYGPQMQYSPEDVKK
IVEFGLEHGVRVLPEIDSPGHTGSWAEAYPEIVTCANMFWWPAEAEWADRLASEPGTGHL
NPLNPKTYQVFKNVIHDVAALFPEPFYHSGADEIIPGCWKADPTIQTFLSNGGTLSQLLE
IFINSTFPYIVSLNRTVVYWEDVLLDANVKVDPSMLPPENTILQTWNNGPNNTKKVVASG
YRAIVSSSDFYYLDCGHGDFLGNDSQYDQKAGSNTENGGSWCGPFKTWQTIYNYDITYGL
SDEEAKLVLGGEVALWSEQADPTVLDARIWPRASAMAEALWSGNQDKTGMKRYADAMDRL
NEWRYRMVARGIGAEPIQPLWCIRNPGMCNTVHPFV
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggcagtttccgataaagccctcttttccatcgtcttcctctttacagcttttgtatct
tcaatctctgcgtctgaatcccaatcccaaatcaatgtgtggcccaaacccagaaccttc
tcgtggccaagcccacaagcgagcctcctgtcccccaattttagcatcacttcccctaac
caccaacacctctcctccgccgtcgcacgttacctccgcctaatactgacggagcaccat
caccccctcgttaccccaaccgtcaacatcactggtcctcccttggagactcttaccatc
atcgtttccgatctcgctgccccactccaccacggagtcgatgagtcctacaccctgatc
gtcccaaggggcggagcggccaatctcacggccgcgacggtgtggggcgccatgagaggc
ctcgagactttctcgcagatcgtgtggggtgaccctttacgagtggccactggtttattc
gtgtgggactcgcccctttttggacatagaggggtgatgctggatacttcgaggaattac
tatggagtggaggatatattgaggacgattggagcaatgagtgccaataagctcaatgtc
tttcactggcacattactgactcgcattccttccctctgctcttgccctcggagcctgat
ctcgccggaaagggatcttatgggccccaaatgcaatactctccggaggatgtgaagaag
attgtggagtttggcttggaacatggggttagggttttgccggagattgactcacccgga
catacaggatcatgggctgaagcatacccagagattgtgacatgtgcaaacatgttttgg
tggcctgctgaagctgaatgggctgaccggctagcatcagaaccaggaacaggccatctc
aatcccttaaaccccaaaacctaccaagtcttcaaaaatgtcattcacgatgtagctgcc
ctgtttccagaaccgttctatcactcaggggctgatgagatcatcccaggttgttggaaa
gcagacccaactattcaaactttcctatcaaatggtggaactctcagtcaactccttgag
atctttatcaactccaccttcccatacattgtttccctaaatcgtacagtggtttactgg
gaagacgttttgttggatgccaacgtcaaagtggatccaagcatgcttccgccagagaat
accattttacaaacatggaacaatggaccaaataacactaaaaaggttgttgcttctggc
taccgagccattgtatcatcttcagatttctactacttggattgtgggcatggggacttt
ctcgggaatgacagtcagtatgatcagaaagcaggtagcaacacagaaaatggtgggtca
tggtgcggcccctttaaaacttggcagacgatatataattatgatataacatatggatta
agcgatgaggaggcaaagctggtattaggtggggaagtggcattgtggtctgagcaagcc
gatccaacagttttggatgctcggatctggccaagagcttctgcaatggcagaggcattg
tggtctgggaaccaagacaagacaggcatgaagaggtatgcagatgcaatggatcggttg
aatgaatggagatatagaatggttgctagagggattggggctgaacccattcagcccctt
tggtgcattaggaatccaggaatgtgtaacacagttcatccctttgtttag

  All links  
No link information was found.   
DBGET integrated database retrieval system