KEGG   Vitis vinifera (wine grape): 100241128Help
Entry
100241128         CDS       T01084                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:vvi01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:vvi00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 340 aa AA seqDB search
MATEPPAPPSAFFFIILVTVFALTPIAHSIPFIVLHGIGDKCSNRGITHFTELLGNWSSS
QGYCIEIGDGTWDSWVLPLLEQTAIVCEKVKEMTELSEGYNIVGLSQGNVIARGVIEFCD
GGPPVKNFISLGGPHAGTASVPLCGSGFICILVDNLIKSGIYSDYVQEHLAPSGYLKIPT
DIISYLEGCRFLPKLNNEIIDKRNSTYKERFSSLQNLVLIMFEHDTILIPKETAWFGYYP
DGSFSSVFPANETELYTEDWIGLKTLDEAGKVKFISVPGNHLAISRSDMKTYMVPYLEDQ
ASTQPVIIDSSSHRGSSSIRNFVVEMVGLTKNRPLLLTVD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggctactgagccgccagcaccaccatcagcattcttcttcatcatcttggtcactgtg
tttgctctcaccccaattgcccactccattcctttcatagttctgcatggaattggggat
aaatgcagtaaccgaggcatcacacacttcactgaacttcttggcaactggtccagctct
caaggatattgcatagaaattggagatggaacatgggattcctgggttctgccccttctg
gaacagactgcaattgtttgtgagaaggtgaaggaaatgactgagcttagtgagggttac
aacatagttggactttctcagggtaacgtgatagctcgtggagttattgagttttgtgat
ggaggacctcctgttaagaatttcatatcacttggaggtcctcatgctggtacagcttcc
gttccactttgtggatctggtttcatatgcattctcgtggacaatttaatcaagtcaggg
atctacagtgactatgttcaggaacacttggctcccagtggttatcttaaaatcccaact
gacattatcagctatctagaagggtgtaggtttcttccaaagcttaataacgaaatcatt
gataagagaaactccacttataaggagcggttttccagcttacagaacttggtgttgatc
atgtttgagcatgacacaattttgatacccaaggaaaccgcctggtttgggtattatcca
gatgggtcattttcttcggtttttccagcaaatgagactgagctctacactgaggactgg
atcggtctgaaaacattggatgaagctggaaaggttaaattcatcagtgttccaggaaat
catctggcaatctcgcgaagtgacatgaaaacatacatggtaccttacttggaggatcaa
gcatcaacccagccagtgatcatagattcttcatctcatagagggtcctcatcaatccga
aattttgtcgtggaaatggttgggctcactaagaataggcctcttctgctcactgtggac
taa

DBGET integrated database retrieval system