KEGG   Vitis vinifera (wine grape): 100241156Help
Entry
100241156         CDS       T01084                                 

Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100241156
   01210 2-Oxocarboxylic acid metabolism
    100241156
   01230 Biosynthesis of amino acids
    100241156
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100241156
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100241156
   00220 Arginine biosynthesis
    100241156
Enzymes [BR:vvi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     100241156
Amino acid related enzymes [BR:vvi01007]
 Aminotransferase (transaminase)
  Class I
   100241156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 526 aa AA seqDB search
MRRFVSGVLSSYQKRSLSHRSLRFFSSTTSLSNSDSPSSSSSAAMPTPVTLETINPKVLE
CEYAVRGEIVTLAQRLQQELQEKPGSLPFDEILYCNIGNPQSLGQQPITFFREVIALCDH
PPILDKSETQGLFSADAIERAWQILDQIPGRATGAYSHSQGIKGLRDTIAAGIEARDGFP
SNPNDIFLTDGASPAVHMMMQLLIRTEKDGILCPIPQYPLYSASIVLHGGTLVPYYLDEA
TGWGLEISELQKQLEDAKSKGITVRALVVINPGNPTGQVLSEDNQRDIVEFCKKEGLVLL
ADEVYQENVYVPDKKFHSFKKISRSMGYGEEDISVVSFQSVSKGYYGECGKRGGYMEVTG
FGADVREQIYKVASVNLCSNITGQILASLVMSPPKVGDESYESYFMEKDGILSSLARRAK
TLEDALNSLEGVTCNKAEGAMYLFPRIHLPEKAIKAAEAAKTAPDAFYARRLLNATGIVV
VPGSGFGQVPGTWHFRCTILPQEDKIPAVVSRLTEFHKGFMEEFRD
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcggagattcgtcagcggcgtgctcagtagttatcagaagcgatctctttctcatcgc
tctcttcgtttcttctcctccacgacttctctctctaactccgattctccttcttcttcc
tcttccgccgccatgcctactcctgttactctcgaaaccatcaaccctaaggtcttagaa
tgtgagtatgctgtccggggtgagattgtcacccttgcccagcggttgcagcaggagtta
caagaaaagccaggttctcttccttttgatgagatactttactgcaacattggaaatcct
caatctcttggtcaacagccaattacttttttccgagaggttattgcactatgtgatcat
ccacctattttggacaaaagtgagacacagggtttgttcagtgcggatgccatagagcga
gcttggcagatcctggatcaaattcctggaagagcaactggtgcatatagtcacagtcag
ggtatcaaaggattgcgtgatactattgctgctggaattgaagctcgtgatggttttcct
tctaatccaaatgacattttcttgactgatggtgcaagcccagcagtccatatgatgatg
cagttactgataagaacggagaaggatggaattctttgtcccattcctcagtaccctttg
tactctgcttcaattgttctacatggtggcactcttgttccttactatcttgatgaagca
actgggtggggcttggagatttcagaacttcagaagcaattggaagatgcaaagtcaaag
ggtatcaccgttagggccttggttgtaataaatccaggcaacccaacggggcaggttctt
tctgaggacaaccagcgagacattgtggaattctgcaagaaagaaggtcttgttcttctg
gcagatgaggtataccaggaaaatgtatatgttcctgacaagaagtttcactcgttcaag
aagatatcccgttctatggggtatggcgaggaagatatctctgtagtgtcatttcagtca
gtctctaaagggtactatggggagtgtggaaaaagaggaggttacatggaggtaactggg
tttggcgctgatgtgcgggaacagatatacaaagtggcatctgtgaatctttgttctaat
atcactggtcaaattcttgcaagccttgtgatgagcccacccaaggttggagatgaatcc
tatgaatcttatttcatggagaaggacggaatactctcatccctggcaaggcgtgcaaag
acactggaagatgcactcaatagcttggagggtgtaacttgcaacaaggcagaaggagca
atgtatctcttcccccgtattcacctgcctgagaaagcaattaaagctgcagaagctgca
aaaactgcccctgatgcattttacgctcgccgcctcctaaatgccactggaattgttgtt
gttcctggatctggcttcggtcaggttcctgggacatggcatttcaggtgcacaatactg
cctcaagaagataagattccggctgttgtctcccgcctgacagaattccacaaaggattc
atggaggagtttcgagactga

DBGET integrated database retrieval system