KEGG   Vitis vinifera (wine grape): 100241220Help
Entry
100241220         CDS       T01084                                 

Definition
beta-galactosidase-like
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100241220
  Lipid metabolism
   00600 Sphingolipid metabolism
    100241220
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100241220
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100241220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 1114 aa AA seqDB search
MASLVAQLAFPSDYNRRVWEDPSFIKWRKKDAHVSLHCHDTVEGSLRYWYERNKVDFIAS
SSAVWNDDAVVGALDCAAFWVKGLPFVKSLSGYWKFYLAPGPTSVPMNFYDSSFEDSTWE
TLPVPSNWQMHGFDRPIYTNIVYPFPLDPPHVPTENPTGCYRTVFHIPHEWKGRRILLHF
EAVDSAFFAWINGVPVGYSQDSRLPAEFEITDYCHPCGSNKKNVLAVQVFRWSDGSYLED
QDQWWLSGIHRDVLLLAKPQVYIEDYFFKSNLGENFSYADIQVEVKIDNSLETSKDSILN
KFSIEAELFDSAKWHDSDEYCDLHSSSVAHMELDPSSSTAIFGFLGYVLVGKLESPKLWS
AEQPYLYTLVVILKDEFGKVVDCESCQVGIRQVSKAPKQLLVNGHPVILRGVNRHEHHPR
LGKTNMESCMVKDLVLMKQNNINAVRNSHYPQHPRWYELCDLFGMYMIDEANIETHGFYD
SQHLKNPTLESSWASSMMDRVISMVERDKNHACIISWSLGNESGYGPNHSALAGWIRGRD
SSRLLHYEGGGARTPSTDIVCPMYMRVWDIVKIAKDPTEMRPLILCEYSHSMGNSNGNIQ
EYWEAIDNTFGLQGGFIWDWVDQGLLKVGADGAKHWAYGGDFGDIPNDLNFCLNGITWPD
RTLHPAVHEVKYVYQPIKISLSESTLKITNTHFYETTKAMEFSWTVCGDGCKLGSGTLSL
PIIEPQSSYSIEFESGPWYSLWASSSAEEHFLTITAKLLQPTRWVEAGHVISSTQILLPA
KREFVPHVIKNKDAPVPGEILGNTIRFYQQNVWEIQFNAQTGTIESWKVGGVTVMNKGIF
PCFWRAPTDNDNGGGAKSYVSKWKAAHLDNLSFITESCSVQNITDHPVKLAVVYLGIPKG
EENSLSRSENPKVLLKVDITYTVYGSGDIIMECNVHPCSDLPPLPRVGVEFQLEKTIDQI
KWYGKGPFECYPDRKAAAHVGVYEQNVGDMHVPYIVPVECSGRADVRWVTFQNKDGFGIY
ASMYGSSPPMQMNASYYSTAELERATHKEKLIKGDDIEVHLDHKHMGLGGDDSWSPCVHE
KYLIPAVPYSFSIRLSPITAAITGYDIYKSQLQN
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttggtggcacagcttgcttttccctcagattataatcgtagagtgtgggag
gatccatcattcatcaagtggagaaaaaaagatgcacatgtttcattgcattgtcatgat
actgttgaaggatctcttagatactggtatgaacgcaacaaagtggattttatagcatct
agttcagcagtttggaatgatgacgctgttgttggagctcttgattgtgctgctttctgg
gtcaagggcctgccttttgttaagtctttgtctggctactggaaattttacttggctcct
ggacctaccagtgttcctatgaatttttatgatagttcatttgaggattctacatgggaa
actttaccagtgccttcgaattggcagatgcatggatttgatcggcctatttatacaaat
atcgtatatccgtttcctcttgatccacctcatgttcctacagaaaatcctactggctgt
tacaggacagtcttccacattcctcacgaatggaagggtcgtaggatattgttacacttt
gaagctgttgattctgccttttttgcatggataaatggagttcctgttggatatagtcag
gatagtagacttcctgctgaatttgaaatcactgattactgtcatccatgtggttccaac
aagaagaatgttcttgctgttcaagtatttagatggagtgatggctcttaccttgaagat
caagatcaatggtggttatccggtattcatcgagacgtgcttcttttagccaagccacag
gtctatattgaagactattttttcaaatcaaacttgggcgaaaatttttcatatgcagat
atacaggttgaagtgaaaattgataactcgctggaaacatcgaaagacagcattcttaac
aaattttctatagaggctgaactgtttgacagtgcgaagtggcatgactccgatgaatat
tgtgatctgcattcatctagtgtggctcatatggaacttgacccatcctcctctactgca
atattcgggtttcttggatatgttctagtgggaaaactggaaagccccaagctttggtct
gcagagcaaccttatctttacactcttgtcgtcatcctcaaagatgaatttgggaaggta
gttgactgtgaatcatgccaagtaggtatacggcaagtatcaaaagccccaaaacagcta
cttgttaatgggcatccagtaattttaagaggagtaaataggcacgaacatcatccacgt
ctggggaagacaaacatggaatcctgcatggttaaggatttggttctaatgaagcaaaac
aatatcaatgctgtgagaaacagccattatccccaacatcctcgatggtacgagttgtgt
gatttgtttggcatgtacatgattgatgaagccaatattgagacccatggtttttatgat
tctcaacatttaaagaaccccacattagaatcaagttgggcttcttctatgatggatcga
gtgataagcatggtggagagggacaaaaatcatgcatgcattatttcttggtccttggga
aatgagtctggttatggacctaatcattctgctttggctggttggattagaggaagggac
tcctctaggctattacattacgaagggggtggagctaggactccatcaacagatattgtc
tgccccatgtatatgcgtgtttgggacattgtaaagattgcaaaagatccaactgaaatg
cgacctttgattctatgcgagtactcacattccatgggaaacagcaacggaaatattcaa
gaatattgggaagctattgataacacatttggattacaaggaggctttatctgggattgg
gttgatcaggggctgctgaaggttggtgcagatggtgctaagcattgggcatatggaggt
gactttggggatatccctaatgatttgaacttctgtctgaatggcattacatggccagat
cgaactcttcatcctgcagtacatgaagttaagtatgtctatcaaccaatcaagatttct
ttaagtgagagcacacttaagataacaaacactcatttttatgaaacaacaaaagcaatg
gagtttagctggactgtctgtggggatggatgcaaacttggatctggaaccctatctctc
cccataatagaaccccagagcagctactctatcgaatttgagtcaggaccatggtattct
ctatgggcttcgtcttctgcagaagaacattttttaacaataactgcaaagctcttgcaa
cccacacgctgggttgaagctggtcatgtcatttcatcaacacaaatcctgttgcctgcc
aaaagagaatttgttcctcatgtcatcaaaaataaagatgctcctgtccctggtgaaatt
cttgggaatacgattagattctaccagcagaatgtttgggagatacaatttaacgctcaa
actggaaccattgaaagctggaaggttggtggagttactgtgatgaataagggcatattc
ccatgcttctggcgggcacctacagataatgacaatgggggaggtgcaaaaagttatgtc
tctaagtggaaagcagcccatcttgataacctatcctttatcactgaaagctgttctgtt
cagaatataacagatcatcctgtaaaactggctgtggtttatcttggcatcccaaagggt
gaggagaattctttatccagatctgagaatccaaaggttttactcaaggttgacataact
tacacagtctatggttctggtgacatcattatggaatgtaatgtccacccatgctctgat
ctcccacccttgccacgtgtgggggttgaatttcagttggaaaaaacaattgatcagatt
aaatggtatggcaaaggaccatttgaatgttatccagatcggaaagcagctgctcatgtg
ggggtctatgagcagaatgtgggtgatatgcatgttccctatattgttcctgtagagtgt
tctggtagagcagatgttaggtgggtaacatttcaaaacaaagatggttttggaatttat
gcatccatgtatggcagctctccaccaatgcaaatgaatgcaagttactatagcacagcg
gagcttgaacgggcaacacataaggaaaagcttatcaaaggagatgatattgaggtgcat
ctggaccacaagcacatgggtttgggtggtgatgatagctggtctccctgtgtccatgag
aaatacctgattccagcggtgccatactcattctctatcaggctgtctccaataactgca
gccataactggctatgacatctacaaatcccagcttcagaactaa

DBGET integrated database retrieval system