KEGG   Vitis vinifera (wine grape): 100241232Help
Entry
100241232         CDS       T01084                                 

Definition
(RefSeq) acid beta-fructofuranosidase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100241232
   00500 Starch and sucrose metabolism
    100241232
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100241232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
2
AA seq 598 aa AA seqDB search
MGRSVSQDSQQNDLTLNAPAESTNISAQFLEPASRGPSAGVSEKSFRLHSGVRAPFPWSN
TMLTWQRTGYHFQPEKNWMNDPNGPMFYGGWYHFFYQYNPDAAVWGNIVWGHAVSKDLIE
WLHLPLAMVADQWYDTNGVWTGSATLLSDGQVIMLYTGATNESVQVQNLAYPADLSDPLL
VDWVKYPGNPVLVPPPGIDDRDFRDPTTAWYWPDGKWRIAIGSKVNKTGISLVYNTEDFK
KYELIEGVLHAVPGTGMWECVDLYPVSLKEDNGLDTSFNGPGVKHVLKASLDDDKNDYYA
IGTYSLESGNWTPDNSNLDVGIGLRYDYGKFYASKTFYDQNKQRRILWGWIGETDGESAD
IKKGWASVQSIPRTVVFDKKTGTNILQWPVAEIKSLRKSSKKFDKLEVGPGSVVTLEVEK
ATQMDITAEFEIDKEALKRIGESDVEYSCGTSGGSAQRGELGPFGLLLLADEGRCEQTPV
YFYVAKGTDGQLKTFFCTDESRSSLANDVDKRIFGSTVPVIKGEKLSMRILVDHSIIESF
AQGGRTCITSRVYPTKAIYGAAQLYVFNNATSASITASIQTWAMKSAYIRPYSSHQES
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcagtgtatcacaagattcacaacaaaatgatttgacattgaatgcaccagcg
gagtctacgaatatatctgcgcagtttttggagccggcgtcacgagggccatcggcgggc
gtgtcagagaagtcattccggctacattccggcgtgagagctccgtttccgtggagcaac
accatgctaacttggcaaagaacgggttatcattttcaaccagaaaagaattggatgaac
gatcccaacggtccaatgttctatggtggatggtatcacttcttctaccagtacaaccca
gatgctgcagtgtggggcaacatagtgtggggccatgccgtgtcaaaggacctcatagag
tggcttcatctccctttggccatggtggctgatcagtggtatgacaccaatggtgtgtgg
actggctctgcaacccttctctctgatgggcaagtgatcatgctctacactggtgccacc
aatgagtcggtgcaggtccagaacctggcataccctgctgacttgtctgatccactcctt
gtggactgggtcaagtacccaggtaacccagtgcttgttcccccaccaggcatcgatgac
agggactttcgtgaccctacaacagcctggtattggcccgatggaaaatggaggattgct
atcggctctaaagttaacaaaactggcatttctttagtttataatactgaggacttcaag
aagtatgagctcatagaaggggttcttcatgctgtccctggcaccggcatgtgggagtgt
gtggacctctaccctgtatcattgaaggaagataatgggttggacacttcctttaatggt
cccggagtcaagcatgtgctcaaggctagccttgatgatgacaagaatgattactatgcc
attgggacttattcgctggagtcaggtaattggactccagataattccaatttggatgtt
ggtattggcctgaggtatgattatggcaagttctatgcttccaagacgttctatgatcaa
aacaagcagaggagaatattgtggggttggattggagaaactgatggcgaatctgctgat
atcaagaagggatgggcatctgttcagagcattccaaggacggtggtcttcgacaagaag
actggtaccaatatacttcagtggccagtggcggagatcaagagtttgagaaagagtagc
aaaaaatttgacaaactagaggttggaccaggatcagttgtgacactagaagtggaaaaa
gccacacagatggacattactgctgagttcgagattgataaagaggctttgaagagaata
ggtgaaagcgatgtggagtacagctgcggcacaagtggtggatctgctcaacggggtgaa
ctgggaccatttggccttctgctcctcgccgacgagggccgttgtgagcagactcctgtg
tatttctatgttgccaaaggcactgatggccagctcaagactttcttctgtactgatgag
tcaaggtcttctctagcaaatgatgtcgataaacgaatttttgggagcacagttccagta
atcaaaggagaaaagttatccatgaggatactggtggatcattccataatagaaagcttt
gcgcaaggtggaaggacatgcatcacatcccgggtgtatccaaccaaggcgatctatgga
gcagctcagctctatgtcttcaacaatgctacctcagccagcatcactgcctcaatccag
acatgggcaatgaagtctgcatacatccgcccctactcatcccatcaggagtcctaa

DBGET integrated database retrieval system