KEGG   Vitis vinifera (wine grape): 100241746Help
Entry
100241746         CDS       T01084                                 

Definition
discs large homolog 1-like protein-like
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vvi00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 403 aa AA seqDB search
MGEAPAFFVDDLQQVFSNGFDPKPKVSESETTVGDKIYAIGEAHEGLALSTRIFDNSTGE
WVIPAVLGTKPEAGKGHSAVLVNEDRILIIKRGSTPDDCIWFLEVDTEFVREQKKTLGTE
VVAWSRGVIGDANKPIVISGPSGVGKGTLISKLMKEFPSMFGFSVSHTTRAPRDKEINGV
HYHFTERSVMEKEIKDVKFLEFANVHGNLYGTSIEAVEVVADAGKRCILDIDVQGARSVR
ASSLEAIFIFICPPSFEELEKRLRARGTETEEQIQKRLRNAEAELEQGQSSGLFDHILVN
DDLDKCYENLKKLLDLDGNVADTFSKPSPKPVELPIGHSVLKINEKVVISCRTQELEKAS
KNLIVLDVSSLKGGAPGRTRGLKMRAMDSFSDVVNGINQLTHS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagctccagctttctttgttgatgatctgcagcaggttttttcaaatgggttt
gatccaaaacccaaagtctctgagtcggaaaccactgtgggggacaaaatatatgcgatt
ggtgaggcacatgaggggttggcattatcgactcggatatttgacaattctacaggcgaa
tgggtgatccctgccgtgttgggaacaaaacccgaagcaggtaagggccattcggctgtg
cttgtaaatgaggatcggatattgatcatcaagaggggttccacccctgatgactgcatt
tggtttcttgaggtggataccgaatttgtaagggagcagaaaaaaactttgggtactgag
gtagttgcttggagtaggggagttattggtgatgccaataagccaattgttattagtggt
ccttctggagtgggtaagggtacattaatatccaaactgatgaaggaatttccatccatg
tttgggttctctgtgagccacacaacccgggctccaagagacaaggaaatcaatggggtt
cattaccatttcacggagcggagtgttatggagaaagagataaaagatgtgaagttcctc
gagtttgctaatgttcatgggaatctctatggaaccagtattgaagctgttgaagtggtt
gcagatgctggaaagagatgcattcttgacattgatgttcaaggggcaaggtccgtgagg
gctagttctcttgaagccattttcatctttatctgtccaccctcatttgaggagcttgag
aagcgccttcgtgcaaggggaacagaaacagaggaacagatccaaaaacgactccggaat
gcagaagcagagcttgaacaaggacaatcatctggtctctttgatcatatcttagtcaac
gatgacctcgacaagtgctatgagaatctcaagaaattgttggacctagacggaaatgtt
gctgatactttctccaaaccttcaccaaaaccagttgagctgcccataggccattcagtg
ttgaaaatcaatgaaaaagtcgtgataagctgtagaactcaggaactagaaaaagcttca
aagaacttgattgtattggatgtatcttcactcaaaggaggggcaccaggacggacaaga
gggctaaaaatgagagctatggactcattttcagatgtcgtgaatgggatcaatcagcta
acacatagctaa

DBGET integrated database retrieval system