KEGG   Vitis vinifera (wine grape): 100242320Help
Entry
100242320         CDS       T01084                                 

Definition
mitogen-activated protein kinase homolog NTF4-like
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Plant hormone signal transduction
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    100242320
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    100242320
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100242320
Protein kinases [BR:vvi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100242320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 410 aa AA seqDB search
MDGEAPLPDADTVMSDAVPPPDPHHQQQHAPVPGMENIPATLSHGGRFIQYNIFGNIFEV
TAKYKPPIMPIGKGAYGIVCSALNSETNEHVALKKIANAFDNKIDAKRTLREIKLLRHMD
HENVVAIRDIIPPPQRTAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLK
YIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRAPELLLNS
SDYTVAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEAELGFLNENAKRY
IRQLPIYRRQTFTEKFPQVHPVAIDLVEKMLTFDPRQRITVEEALAHPYLTSLHDISDEP
ICTTPFSFDFEQHALSEEQMKELIYREALAFNPDVVSALFNHMLMISCCI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggatggagaagcgccactgccggacgccgacacggtgatgtccgacgcggtaccgccg
ccggatccgcatcaccagcagcagcatgccccggtgcctgggatggagaatattccggcg
acgcttagccacggcggcagattcatccagtacaacatcttcgggaacatcttcgaggtc
acggccaaatacaagcctccaatcatgcccatagggaagggcgcttacggcatcgtgtgc
tcggctctgaattcggagacgaacgagcacgtggcgctaaagaaaatagcgaatgcattc
gataacaaaatcgatgcgaagaggacgcttcgggagatcaagcttttgcggcacatggat
catgaaaacgttgttgcaattagagatattataccaccacctcagaggacagcatttaat
gatgtttacattgcatatgagctaatggatactgaccttcatcaaatcattcgttccaat
caagcactttcagaagaacactgtcagtatttcctctatcagatcctccgtgggctgaaa
tatatacattcggcaaatgttcttcacagggacttaaagcctagcaatctcctcctgaat
gccaattgtgatttgaaaatatgtgattttgggctagctcgtgtcacctctgaaactgat
ttcatgacagaatatgttgttacgagatggtaccgagctccagagctgttgttgaactct
tcagattacactgtggccattgatgtatggtcagtaggttgcattttcatggaattgatg
gatcggaagcctttgtttcctggcagagatcatgtgcatcagctacgtttgcttatggag
ctgattggcaccccatcagaggctgagttggggtttttgaatgaaaatgcaaagagatac
attcggcaacttcctatttaccgtcggcagacattcactgaaaagttcccacaagttcac
cctgtagctatcgatcttgttgaaaagatgttgacatttgatcccaggcagaggattaca
gttgaggaagccctagcacatccctatttaacgtctctgcacgacatcagtgatgagcct
atatgcacgactcccttcagcttcgattttgagcagcacgcactgtccgaagagcagatg
aaggagctcatctaccgagaggcactcgcatttaaccccgatgtggtttctgcgcttttt
aatcatatgctcatgatttcctgctgtatataa

DBGET integrated database retrieval system