KEGG   Vitis vinifera (wine grape): 100242517Help
Entry
100242517         CDS       T01084                                 

Definition
6-phosphofructokinase 4, chloroplastic-like
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:vvi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vvi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vvi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:vvi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:vvi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vvi00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 533 aa AA seqDB search
MDLSLSSFARSSIPPPLKSCNLTSLSNFPNYSFKSRNFSLTPLISRQNRRIRAQYSCNSG
SGGGGGGDDDGFVVDEVPHLTNFLPDLPSYPNPLQQNLAYTIVKKNFVSPEDVVAQKIVV
QKGSPRGVHFRRAGPREKVYFKSEEVRACIVTCGGLCPGINTVIREIVCGLNYMYGVHDI
LGIEGGYRGFYSKNTIQLTPKVVNDIHKRGGTFLRTSRGGHDTDKIVDNIQDRGINQVYI
IGGDGTQKGAALIYKEVEKRGLQVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAA
HVEVESVENGVGIVKLMGRYSGFIAMFATLASRDVDCCLIPESPFYLEGQGGLFEFIEQR
LKENGHVVIVLAEGAGQEYVAQSMHAVSEKDASGNRLLLDVGLWLSQKIKDHFTKVQKMA
VNMKYIDPTYMIRAIPSNASDNIYCTLLAHSAVHGAMAGYTGFTIGPVSSRHAYIPIDRV
TETTKTIKLTDRMWARLLSSTNQPSFLKGSPVMQERVDKETIEMIDNMKITSI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggatctttctctctcttcgtttgctcgctcttccattccacctccattgaaatcctgc
aatctgacttcactctccaatttccccaattacagtttcaaatccaggaatttttccctc
acgccgttgatttcgcgccaaaatcggcggatcagagctcaatattcatgtaattccggc
agtggcggtggaggtggaggtgatgatgatggttttgttgtggatgaagttccgcacttg
acgaattttctgcctgatttgccgtcatacccaaacccattgcaacagaacttagcttat
acaatagtcaagaaaaattttgttagcccagaagacgtggtagcacaaaaaattgttgtt
caaaagggaagtcctagaggagttcattttcggcgagcagggcctcgagaaaaggtttat
ttcaagtcagaggaagtacgtgcttgtatagtgacatgtggaggattgtgccccggaatc
aacacagtgattcgggagatagtatgtggcttgaattatatgtatggtgttcatgatata
cttgggattgagggaggatacagaggcttttactccaaaaataccattcagttgacacct
aaagttgtcaacgatatccataaacgtggtggcacctttcttcgtacttcccgagggggt
catgataccgacaagatagttgataatattcaggaccggggtataaatcaggtgtacatt
attggaggtgatggtactcaaaaaggagcagcattaatttacaaggaagtagagaaacgt
ggtcttcaagtggcagttgcaggaatccctaagacaatcgacaatgacattgctgtgata
gacaagtcttttggttttgatactgctgttgaggaagctcagagagcaatcaatgctgca
catgtggaagttgaaagtgtagaaaatggagttggaattgtaaaacttatgggccgatat
agcgggttcattgccatgtttgcaactttggcgagcagagatgtggattgttgcttgatt
ccagagtctccattctatcttgaaggccagggtgggctttttgaatttattgaacagcgg
ctcaaagaaaatgggcacgtagttattgtgttggcagaaggagcagggcaggaatacgtt
gctcagagcatgcatgcagttagtgagaaagatgcctcagggaacaggctacttctagat
gttggtctttggctatctcaaaagatcaaggatcatttcacaaaggtacagaagatggca
gtaaatatgaaatatatagatccaacatacatgatccgagctattccaagtaatgcatca
gacaatatctactgcaccctccttgcacatagtgctgtacatggggccatggcagggtac
actggcttcacgattggacctgtaagcagccgacatgcttatattcctattgatcgcgta
actgagactacaaagaccatcaagttgacggatcgtatgtgggcgagacttctttcatca
acgaaccaacctagtttcttaaaagggagcccagtgatgcaagaaagagttgataaagag
accattgaaatgattgacaacatgaagattacttctatatag

DBGET integrated database retrieval system