KEGG   Vitis vinifera (wine grape): 100242517Help
Entry
100242517         CDS       T01084                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 4, chloroplastic
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00010  Glycolysis / Gluconeogenesis
vvi00030  Pentose phosphate pathway
vvi00051  Fructose and mannose metabolism
vvi00052  Galactose metabolism
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
vvi01200  Carbon metabolism
vvi01230  Biosynthesis of amino acids
vvi03018  RNA degradation
Module
vvi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100242517
   00030 Pentose phosphate pathway
    100242517
   00051 Fructose and mannose metabolism
    100242517
   00052 Galactose metabolism
    100242517
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100242517
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100242517
Protein phosphatases and associated proteins [BR:vvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100242517
Messenger RNA biogenesis [BR:vvi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100242517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat SEFIR
Motif
Other DBs
NCBI-GeneID: 100242517
NCBI-ProteinID: XP_002282309
UniProt: D7U799
Position
16
AA seq 533 aa AA seqDB search
MDLSLSSFARSSIPPPLKSCNLTSLSNFPNYSFKSRNFSLTPLISRQNRRIRAQYSCNSG
SGGGGGGDDDGFVVDEVPHLTNFLPDLPSYPNPLQQNLAYTIVKKNFVSPEDVVAQKIVV
QKGSPRGVHFRRAGPREKVYFKSEEVRACIVTCGGLCPGINTVIREIVCGLNYMYGVHDI
LGIEGGYRGFYSKNTIQLTPKVVNDIHKRGGTFLRTSRGGHDTDKIVDNIQDRGINQVYI
IGGDGTQKGAALIYKEVEKRGLQVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAA
HVEVESVENGVGIVKLMGRYSGFIAMFATLASRDVDCCLIPESPFYLEGQGGLFEFIEQR
LKENGHVVIVLAEGAGQEYVAQSMHAVSEKDASGNRLLLDVGLWLSQKIKDHFTKVQKMA
VNMKYIDPTYMIRAIPSNASDNIYCTLLAHSAVHGAMAGYTGFTIGPVSSRHAYIPIDRV
TETTKTIKLTDRMWARLLSSTNQPSFLKGSPVMQERVDKETIEMIDNMKITSI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggatctttctctctcttcgtttgctcgctcttccattccacctccattgaaatcctgc
aatctgacttcactctccaatttccccaattacagtttcaaatccaggaatttttccctc
acgccgttgatttcgcgccaaaatcggcggatcagagctcaatattcatgtaattccggc
agtggcggtggaggtggaggtgatgatgatggttttgttgtggatgaagttccgcacttg
acgaattttctgcctgatttgccgtcatacccaaacccattgcaacagaacttagcttat
acaatagtcaagaaaaattttgttagcccagaagacgtggtagcacaaaaaattgttgtt
caaaagggaagtcctagaggagttcattttcggcgagcagggcctcgagaaaaggtttat
ttcaagtcagaggaagtacgtgcttgtatagtgacatgtggaggattgtgccccggaatc
aacacagtgattcgggagatagtatgtggcttgaattatatgtatggtgttcatgatata
cttgggattgagggaggatacagaggcttttactccaaaaataccattcagttgacacct
aaagttgtcaacgatatccataaacgtggtggcacctttcttcgtacttcccgagggggt
catgataccgacaagatagttgataatattcaggaccggggtataaatcaggtgtacatt
attggaggtgatggtactcaaaaaggagcagcattaatttacaaggaagtagagaaacgt
ggtcttcaagtggcagttgcaggaatccctaagacaatcgacaatgacattgctgtgata
gacaagtcttttggttttgatactgctgttgaggaagctcagagagcaatcaatgctgca
catgtggaagttgaaagtgtagaaaatggagttggaattgtaaaacttatgggccgatat
agcgggttcattgccatgtttgcaactttggcgagcagagatgtggattgttgcttgatt
ccagagtctccattctatcttgaaggccagggtgggctttttgaatttattgaacagcgg
ctcaaagaaaatgggcacgtagttattgtgttggcagaaggagcagggcaggaatacgtt
gctcagagcatgcatgcagttagtgagaaagatgcctcagggaacaggctacttctagat
gttggtctttggctatctcaaaagatcaaggatcatttcacaaaggtacagaagatggca
gtaaatatgaaatatatagatccaacatacatgatccgagctattccaagtaatgcatca
gacaatatctactgcaccctccttgcacatagtgctgtacatggggccatggcagggtac
actggcttcacgattggacctgtaagcagccgacatgcttatattcctattgatcgcgta
actgagactacaaagaccatcaagttgacggatcgtatgtgggcgagacttctttcatca
acgaaccaacctagtttcttaaaagggagcccagtgatgcaagaaagagttgataaagag
accattgaaatgattgacaacatgaagattacttctatatag

DBGET integrated database retrieval system