KEGG   Vitis vinifera (wine grape): 100242541Help
Entry
100242541         CDS       T01084                                 

Definition
eukaryotic translation initiation factor 3 subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
vvi  Vitis vinifera (wine grape)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100242541
Translation factors [BR:vvi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100242541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 222 aa AA seqDB search
MEDWEDEPITPLGKKEEPKNKWDDEDLDDDNVKESWEDEDEPAPAPVIQPPAEKPPKKPV
EKATEKKGKAVEAVTEVTLDPVAEKIRQQRLIEEADYKSTTELFAKRGDEKTLDSFIPKS
ESDFVEYAELISHKLRSYEKSFHYIGLLKAVMRLSMASLKAADAKEIASSVTAIANEKLK
AEKEANTGKKKIGAKKKQLHVDKPDDDVVVNAYDDIDDYDFM
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggaagactgggaggatgagccaattacacctcttggaaaaaaagaggaacctaagaat
aagtgggatgatgaagatttggatgacgataatgtgaaggagtcatgggaggatgaagat
gagcctgctccggcacctgtaatacaacctcctgctgaaaagcctcccaagaaacctgtg
gaaaaagctactgagaagaaaggaaaagctgttgaagcagtaacagaagtcacactagat
cctgtagcagagaaaattagacagcagaggcttattgaggaagcggattataaatccacg
acagaattgtttgctaagagaggtgatgagaagactcttgatagtttcattcctaaatct
gaaagtgacttcgtagaatatgcggagctcatttctcataagctgcgatcgtatgagaaa
agtttccactatattggattgctcaaggctgtaatgagactgtcaatggcttccttaaaa
gcagctgatgcaaaagaaatagcctcatctgtcacagcaattgcaaatgagaagctgaaa
gcggaaaaggaagccaatactggtaaaaagaaaattggtgcaaagaagaagcaacttcat
gttgataagccggatgacgacgtagttgttaatgcttatgatgatatcgatgactatgat
tttatgtga

DBGET integrated database retrieval system