KEGG   Vitis vinifera (wine grape): 100242541Help
Entry
100242541         CDS       T01084                                 

Definition
eukaryotic translation initiation factor 3 subunit J-like
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
vvi  Vitis vinifera (wine grape)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:vvi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 222 aa AA seqDB search
MEDWEDEPITPLGKKEEPKNKWDDEDLDDDNVKESWEDEDEPAPAPVIQPPAEKPPKKPV
EKATEKKGKAVEAVTEVTLDPVAEKIRQQRLIEEADYKSTTELFAKRGDEKTLDSFIPKS
ESDFVEYAELISHKLRSYEKSFHYIGLLKAVMRLSMASLKAADAKEIASSVTAIANEKLK
AEKEANTGKKKIGAKKKQLHVDKPDDDVVVNAYDDIDDYDFM
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggaagactgggaggatgagccaattacacctcttggaaaaaaagaggaacctaagaat
aagtgggatgatgaagatttggatgacgataatgtgaaggagtcatgggaggatgaagat
gagcctgctccggcacctgtaatacaacctcctgctgaaaagcctcccaagaaacctgtg
gaaaaagctactgagaagaaaggaaaagctgttgaagcagtaacagaagtcacactagat
cctgtagcagagaaaattagacagcagaggcttattgaggaagcggattataaatccacg
acagaattgtttgctaagagaggtgatgagaagactcttgatagtttcattcctaaatct
gaaagtgacttcgtagaatatgcggagctcatttctcataagctgcgatcgtatgagaaa
agtttccactatattggattgctcaaggctgtaatgagactgtcaatggcttccttaaaa
gcagctgatgcaaaagaaatagcctcatctgtcacagcaattgcaaatgagaagctgaaa
gcggaaaaggaagccaatactggtaaaaagaaaattggtgcaaagaagaagcaacttcat
gttgataagccggatgacgacgtagttgttaatgcttatgatgatatcgatgactatgat
tttatgtga

DBGET integrated database retrieval system