KEGG   Vitis vinifera (wine grape): 100243029Help
Entry
100243029         CDS       T01084                                 

Definition
mitochondrial cytochrome c
Orthology
K08738  
cytochrome c
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100243029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 112 aa AA seqDB search
MASFDEAPPGNPAAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAA
NKNMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQATA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtttgatgaagcacctcctggcaatcccgctgctggagagaagatcttcaag
accaagtgcgctcagtgccacaccgtcgacaaaggcgctggtcacaagcaaggacccaat
ctgaatggccttttcggtaggcagtctggcacaactcccggttactcgtactctgctgct
aacaagaacatggctgttatttgggaggaaaagacattgtatgactacttgctgaaccca
aagaagtacattcctggaacaaagatggtgttccctggactaaagaagcctcaggatcgg
gccgacttgattgcatatttgaagcaagccactgcttaa

DBGET integrated database retrieval system