KEGG   Vitis vinifera (wine grape): 100243048Help
Entry
100243048         CDS       T01084                                 

Definition
(RefSeq) magnesium-chelatase subunit ChlD, chloroplastic
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00860  Porphyrin and chlorophyll metabolism
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100243048
Enzymes [BR:vvi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     100243048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA Sigma54_activat VWA_3 AAA_5 MCM PAXIP1_C RXT2_N CCDC53 Adeno_terminal CAP_N DUF5101 Dscam_C AAA_2
Motif
Other DBs
NCBI-GeneID: 100243048
NCBI-ProteinID: XP_010651832
Position
6
AA seq 747 aa AA seqDB search
MAVSSTAPPCYSLSTLHSSLFPSFKSRSLLSFSSKPKRAQRRFVVQASATLESSNGAIVA
EESDNSTSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGTAKTVMARGLHA
ILPPIDVVVGSIANADPTRPEEWEDGLAEQVEYDSAGNIKTQIVRSPFVQIPLGVTEDRL
VGSVDVEESVKTGTTVFQPGLLAEAHRGVLYVDEINLLDEGISNLLLNVLAEGVNIVERE
GISFRHPCKPLLIATYNPEEGAVREHLLDRVAINLSADLPMSFEDRVAAVGIATQFQERS
NEVFQMVEEETEYAKTQIILAREYLKDVSISRDQLKYLVMEALRGGCQGHRAELYAARVA
KCLTALEGREKVNVDDLKKAVELVILPRSIINENPPDQQNQQPPPPPPPPQNEDSGEEQN
EEENQEDENDKENEQQEQIPEEFIFDAEGGLVDEKLLFFAQQAQRRRGRAGRAKNVIFSE
DRGRYIKPMLPKGPVKRLAVDATLRAAAPYQKLRREKNAQKGRKVFVEKTDMRAKRMARK
AGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVAIIPFRGDSAEVLLPPSRS
IAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGRVMIVAITDGRANISLKRST
DPEAAAAADAPRPSAQELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAKEIARIAQG
KYYYLPNASDAVISATTKEALSVLKNS
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttcatcaacagcaccgccatgttactctctctctaccctccattcttccctt
ttcccttccttcaaatcacgctctcttctttcgttttcttccaagccaaagcgcgcccaa
aggcgttttgttgttcaggcatctgcaactcttgagtccagcaatggtgccattgttgct
gaagagtccgacaacagcacttcatatggaaggcagttcttcccattggctgccgtggtt
ggtcaggatgctattaaaactgctctgttgcttggggctattgaccgtgagatcggaggg
attgccatctctgggaaaagaggaactgccaagacagtaatggcacgtggactgcatgca
attttgcccccaattgatgttgttgttggttcaatagcaaatgctgatcccacccgccca
gaagaatgggaagatggactagctgaacaagtggaatatgattctgctggtaacatcaag
actcagattgtcagatctccctttgtccagattccacttggagtcacagaggacagacta
gttggatctgttgatgttgaggagtctgtaaaaactggaactactgttttccagccgggc
cttcttgctgaagctcatagaggtgttctctatgttgacgagataaatcttttggacgag
ggtatcagtaatttgcttcttaatgtattggcagaaggagttaatattgtggaaagagag
ggaatcagcttcaggcacccatgcaagccacttctgattgccacttataacccagaagag
ggtgctgtacgtgaacacttactagatcgtgttgcaattaacttgagtgcagatcttcca
atgagctttgaagatcgtgttgcagctgtaggaattgccacacaatttcaggaacgcagt
aatgaagtttttcaaatggttgaggaagaaacagaatatgcaaagactcagatcattttg
gctagggaatatttgaaggatgttagtatcagcagagaccaattaaagtatctggttatg
gaagccctacgaggtggttgccagggacacagagctgagctgtatgctgctcgtgttgca
aaatgtttaactgctttagaaggacgtgaaaaagtcaatgtggatgatctgaaaaaagct
gtagaactggtcattctcccccgttcaatcatcaatgagaatccaccagaccagcaaaac
caacagcctccacctccaccacctcctccccaaaatgaagattctggagaagagcagaat
gaggaagaaaatcaagaggatgaaaatgataaggaaaatgaacaacaggaacaaatacct
gaagagtttatctttgatgcagaaggtggtttggtggatgagaaacttctcttctttgca
caacaagcacagagacgacgtgggagggccgggagagcaaagaatgttatattttctgag
gatagaggacgatatattaagcccatgcttccaaagggtcctgtaaagagattagctgtt
gatgcaacccttagagcagcagcaccatatcaaaagttgcgaagggaaaaaaatgcccag
aagggtaggaaagtttttgtagagaaaactgacatgagagcaaaaagaatggcacgaaaa
gctggagcattggtgatatttgtggttgatgcaagtggcagcatggctctgaaccgaatg
cagaatgcaaaaggtgcagcactcaaattattggcagagagttatactagcagagatcag
gttgctatcattccatttcgtggagactctgcagaagttctcctgcctccttccagatca
attgcaatggcaagaaaacggcttgagagacttccttgtggtggaggttcccccctagct
catggtctaaccacagctgtcagggttgggctaaatgcagagaagagtggtgatgttggg
cgtgtgatgattgttgcgataactgacggtagagccaacatatcattgaaaagatctact
gaccctgaggctgctgctgctgctgatgcccccagaccttctgcccaagagttaaaggat
gagattctggaagttgctgggaaaatatacaaagcagggatgtctctgctcgtgatcgac
actgaaaacaagttcgtctcaactggttttgccaaggagattgcaagaattgctcaaggg
aaatactactacttgccaaatgcttccgacgcggtcatctcagccaccacaaaggaagct
ctttcagtcctaaaaaattcatga

DBGET integrated database retrieval system