KEGG   Vitis vinifera (wine grape): 100243048Help
Entry
100243048         CDS       T01084                                 

Definition
(RefSeq) magnesium-chelatase subunit ChlD, chloroplastic
  KO
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100243048
Enzymes [BR:vvi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     100243048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 747 aa AA seqDB search
MAVSSTAPPCYSLSTLHSSLFPSFKSRSLLSFSSKPKRAQRRFVVQASATLESSNGAIVA
EESDNSTSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGTAKTVMARGLHA
ILPPIDVVVGSIANADPTRPEEWEDGLAEQVEYDSAGNIKTQIVRSPFVQIPLGVTEDRL
VGSVDVEESVKTGTTVFQPGLLAEAHRGVLYVDEINLLDEGISNLLLNVLAEGVNIVERE
GISFRHPCKPLLIATYNPEEGAVREHLLDRVAINLSADLPMSFEDRVAAVGIATQFQERS
NEVFQMVEEETEYAKTQIILAREYLKDVSISRDQLKYLVMEALRGGCQGHRAELYAARVA
KCLTALEGREKVNVDDLKKAVELVILPRSIINENPPDQQNQQPPPPPPPPQNEDSGEEQN
EEENQEDENDKENEQQEQIPEEFIFDAEGGLVDEKLLFFAQQAQRRRGRAGRAKNVIFSE
DRGRYIKPMLPKGPVKRLAVDATLRAAAPYQKLRREKNAQKGRKVFVEKTDMRAKRMARK
AGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVAIIPFRGDSAEVLLPPSRS
IAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGRVMIVAITDGRANISLKRST
DPEAAAAADAPRPSAQELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAKEIARIAQG
KYYYLPNASDAVISATTKEALSVLKNS
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttcatcaacagcaccgccatgttactctctctctaccctccattcttccctt
ttcccttccttcaaatcacgctctcttctttcgttttcttccaagccaaagcgcgcccaa
aggcgttttgttgttcaggcatctgcaactcttgagtccagcaatggtgccattgttgct
gaagagtccgacaacagcacttcatatggaaggcagttcttcccattggctgccgtggtt
ggtcaggatgctattaaaactgctctgttgcttggggctattgaccgtgagatcggaggg
attgccatctctgggaaaagaggaactgccaagacagtaatggcacgtggactgcatgca
attttgcccccaattgatgttgttgttggttcaatagcaaatgctgatcccacccgccca
gaagaatgggaagatggactagctgaacaagtggaatatgattctgctggtaacatcaag
actcagattgtcagatctccctttgtccagattccacttggagtcacagaggacagacta
gttggatctgttgatgttgaggagtctgtaaaaactggaactactgttttccagccgggc
cttcttgctgaagctcatagaggtgttctctatgttgacgagataaatcttttggacgag
ggtatcagtaatttgcttcttaatgtattggcagaaggagttaatattgtggaaagagag
ggaatcagcttcaggcacccatgcaagccacttctgattgccacttataacccagaagag
ggtgctgtacgtgaacacttactagatcgtgttgcaattaacttgagtgcagatcttcca
atgagctttgaagatcgtgttgcagctgtaggaattgccacacaatttcaggaacgcagt
aatgaagtttttcaaatggttgaggaagaaacagaatatgcaaagactcagatcattttg
gctagggaatatttgaaggatgttagtatcagcagagaccaattaaagtatctggttatg
gaagccctacgaggtggttgccagggacacagagctgagctgtatgctgctcgtgttgca
aaatgtttaactgctttagaaggacgtgaaaaagtcaatgtggatgatctgaaaaaagct
gtagaactggtcattctcccccgttcaatcatcaatgagaatccaccagaccagcaaaac
caacagcctccacctccaccacctcctccccaaaatgaagattctggagaagagcagaat
gaggaagaaaatcaagaggatgaaaatgataaggaaaatgaacaacaggaacaaatacct
gaagagtttatctttgatgcagaaggtggtttggtggatgagaaacttctcttctttgca
caacaagcacagagacgacgtgggagggccgggagagcaaagaatgttatattttctgag
gatagaggacgatatattaagcccatgcttccaaagggtcctgtaaagagattagctgtt
gatgcaacccttagagcagcagcaccatatcaaaagttgcgaagggaaaaaaatgcccag
aagggtaggaaagtttttgtagagaaaactgacatgagagcaaaaagaatggcacgaaaa
gctggagcattggtgatatttgtggttgatgcaagtggcagcatggctctgaaccgaatg
cagaatgcaaaaggtgcagcactcaaattattggcagagagttatactagcagagatcag
gttgctatcattccatttcgtggagactctgcagaagttctcctgcctccttccagatca
attgcaatggcaagaaaacggcttgagagacttccttgtggtggaggttcccccctagct
catggtctaaccacagctgtcagggttgggctaaatgcagagaagagtggtgatgttggg
cgtgtgatgattgttgcgataactgacggtagagccaacatatcattgaaaagatctact
gaccctgaggctgctgctgctgctgatgcccccagaccttctgcccaagagttaaaggat
gagattctggaagttgctgggaaaatatacaaagcagggatgtctctgctcgtgatcgac
actgaaaacaagttcgtctcaactggttttgccaaggagattgcaagaattgctcaaggg
aaatactactacttgccaaatgcttccgacgcggtcatctcagccaccacaaaggaagct
ctttcagtcctaaaaaattcatga

DBGET integrated database retrieval system