KEGG   Vitis vinifera (wine grape): 100243120Help
Entry
100243120         CDS       T01084                                 

Definition
protein disulfide isomerase-like 2-3
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100243120
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100243120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 433 aa AA seqDB search
MARSPPLITLPFLTIFIVVQLSATAYGLYGPSSPVVQLNPSNFKSKVLNSNGVVLVEFFA
PWCGHCKALTPTWEKAASVLKGVATVAALDADANQALAQEYGIRGFPTIKVFAPGKPPVD
YQGARDVKPIAEFALQQIKALLKERLSGKATGGSSEKSEISSSVELTSSNFDELVLKSKD
LWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSDKSLMSRFSVQGFPTILVF
GADKDTPVPYEGARTASAIESFALEQLETNVAPPEVTELTGPDVMEEKCGSAAICFVAFL
PDILDSKAEGRNKYLEMMLSIAEKFKRSPYSYVWAAAGKQADLEKQVGVGGYGYPALVAL
NVKKGAYAPLKSAFELDQIIGFVKEAGHGGKGILPLASTPVVVKTEPWDGKDGEIIEEDE
FSLEELMGDDATS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatcaccaccgttgatcacacttccatttctgaccatcttcatagtcgtccaa
ctgtctgcaaccgcatatgggttgtacggcccatcgtcgcctgtggttcagctcaatccc
tccaacttcaagtccaaggttctgaactcaaatggggttgttttggttgagttctttgca
ccttggtgtggccactgtaaagctttgacacccacatgggagaaggcagcttctgttttg
aaaggcgttgccactgtggcagctcttgatgctgatgctaaccaggccctcgctcaggaa
tatgggataagaggatttccaaccataaaggtctttgcaccagggaaacctccggtggat
taccaaggagctagagatgtcaaacccattgcagaatttgcactccagcagataaaggca
cttctgaaagagcgtttaagtggaaaggcaactggaggatcaagtgagaaatctgaaatc
agttcatcagtagaattgacttccagcaattttgatgaactggtgcttaaaagtaaagat
ctttggattgtcgagttctttgcaccttggtgtggacactgtaagaagctggctcctgag
tggaagaaggctgctaataacttgaaggggaaagtgaagctggggcatgttgactgtgac
tcagacaagtctctgatgagcaggtttagtgtgcaaggattccccactatcttggtgttc
ggtgctgacaaagatactccagtaccttatgagggtgcaagaactgcctcagcaattgaa
tcatttgctctggagcagctggaaacgaatgttgcaccccctgaagtgactgagctgact
ggcccagatgtcatggaggagaagtgtggctcagctgccatttgttttgttgctttcctt
cctgacattttggactccaaggcagaaggaaggaacaaataccttgagatgatgttatca
attgcagagaagttcaaaaggagtccttacagctatgtttgggcagcagcaggtaagcag
gcagatcttgagaagcaggtaggcgttgggggatacgggtatccagctttggtagcctta
aatgttaagaaaggtgcatatgctccacttaagagcgcatttgagttagaccagattata
gggtttgtgaaggaagctggacatgggggaaagggcattctgcctctggcaagtactcct
gtggttgtgaagacagagccttgggatggtaaagatggggagatcattgaagaggatgag
ttctcccttgaagaactcatgggggatgatgctaccagttag

DBGET integrated database retrieval system