KEGG   Vitis vinifera (wine grape): 100243268Help
Entry
100243268         CDS       T01084                                 

Definition
(RefSeq) josephin-like protein
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100243268
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C86
   100243268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 385 aa AA seqDB search
MAAAEDTTQIYHERQRLQYCLLHALNNLFQEKDIFTRAKLNAIAEKLSLDDPNKETWTPL
SVLFKPHHNMITGNYDINVLTAALEGKGKSAIWHDRRNGASSIDLDGAEDTLMGIMLNIS
VRRFGGIWNGRHWFTLRKMGGVWYNLDSDLKSPQSFKDVEEVKKFLDCIIGGGGEIFLVM
NCKDLGEEFLHRDFRRYMTLSVEDPDTVDFICIWVISETDYCKDDSLTTPLLLKEKMSAI
IGKRVSYSPVVSHHTIITYQRRLFGERGEKPKGPASKRGSALDCKRAAEEAKGASGNNRL
RLFKTPVLSPMGLLKRLGDKMATAFRFVFTKKKKKRLSARTASSGKSKKFIAPDDSHRSE
AIADCIEFINSSALNRSNSVSANSH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagaggacacgacgcagatctatcacgaaaggcaaagattacagtactgc
ctcttgcatgctctcaataacctgtttcaggagaaggacatattcactagagcaaagctg
aatgccatagccgaaaagctcagtcttgatgacccaaataaggaaacatggacaccatta
tctgtgttattcaagcctcatcacaatatgatcactggaaactacgacataaacgttcta
actgcagccttggaagggaaagggaaaagtgcgatttggcatgatcgccgtaatggtgct
tcttcgattgatcttgatggtgctgaagatactttaatgggtattatgcttaacatctca
gttagacggtttggtgggatttggaatggtaggcattggtttacattgagaaagatgggt
ggggtttggtataatttggatagtgatctgaagtctcctcaatcctttaaagatgttgaa
gaagttaagaaattcttggattgcatcattggtggtggtggagagatttttcttgtcatg
aattgtaaagacctaggcgaagagtttttgcatagagatttcaggagatacatgacttta
agcgtggaagatccagatacagtagattttatatgcatttgggttatctctgaaacagat
tactgcaaagatgattcacttacaaccccccttttgctaaaggaaaagatgtcggctata
ataggcaaacgagtgagttacagcccagttgttagtcaccacaccatcatcacataccaa
agacgactcttcggtgagagaggtgagaagccaaaagggcctgcttctaaaagagggtct
gccttggattgtaagagagctgctgaggaggccaaaggggcttctgggaataacagactc
aggctgttcaaaacaccagtactctcacccatgggacttctcaagcgccttggtgataag
atggccacagcctttcggtttgtattcacgaagaagaagaagaagaggctttcagccagg
actgcttcatcagggaaatccaagaaattcatcgcccctgatgattctcacagaagtgaa
gccatagctgattgcatcgagttcatcaactcatccgctctcaacagatcaaactctgtt
tctgcaaattctcactag

DBGET integrated database retrieval system