KEGG   Vitis vinifera (wine grape): 100243294Help
Entry
100243294         CDS       T01084                                 

Gene name
CBL01
Definition
(RefSeq) calcineurin B-like protein 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
vvi  Vitis vinifera (wine grape)
Brite
Protein phosphatases and associated proteins [BR:vvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100243294 (CBL01)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_9 EF-hand_8 EF-hand_4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 100243294
NCBI-ProteinID: XP_002275887
UniProt: C4P7Y8
Position
2
AA seq 213 aa AA seqDB search
MGCFQSTARKQFPGHEDPVILASQTAFSVSEVEALFELFKSISSSVIDDGLINKEEFQLA
LFKNRKKENLFANRIFDLFDVKRKGVIDFGDFVRSLNVFHPNAPQEDKIDFSFKLYDLDS
TGFIERQEVKQMLIALLCESEMKLADETIEIILDKTFLEADVNQDGRIDKSEWQNFVSRN
PSLLKIMTLPYLRDITTTFPSFVFNSEVDEIAT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggctgctttcagtcaacagcaagaaagcagtttcctggacatgaggacccagtaatt
cttgcttcccaaacagcttttagtgtgagtgaagttgaagcactatttgagctattcaag
agcattagcagttctgtaattgatgatgggttaataaacaaggaagagtttcaattggct
ctattcaagaacagaaagaaggagaatctctttgcaaataggatctttgatctttttgat
gttaagcggaagggagtcattgattttggtgactttgtcaggtcactaaatgttttccat
ccaaatgccccacaagaagacaaaattgatttttcattcaagctctatgatttggatagc
acaggattcattgagcggcaagaggtcaaacaaatgttaattgcacttctgtgtgaatct
gaaatgaagttggctgatgaaaccatcgagataatacttgataagacattcttggaagct
gacgtaaatcaggatgggaggattgataaatctgagtggcagaattttgtttctcggaac
ccatcattgttgaagataatgacacttccttatctaagggacataacgacaacctttccg
agctttgtgtttaattcagaggtggatgagattgctacataa

DBGET integrated database retrieval system