KEGG   Vitis vinifera (wine grape): 100243415Help
Entry
100243415         CDS       T01084                                 

Definition
protoporphyrinogen oxidase, chloroplastic-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100243415
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100243415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 549 aa AA seqDB search
MPTLTLADPPTLRLLSPVNLRRSTSISSPFFCRPSRNNCTGPWRVRCAVAGESTISSSKV
GDGNNYSPVDCVIVGAGISGLCIAQALATKHGDVGSNVIVTEARDRVGGNITTMEGDGYL
WEEGPNSFQPSDSMLTMAVDSGLKDDLVLGDPNAPRFVLWNGKLRPVPSKPTDLPFFDLM
SFPGKLRAGFGALGIRPPPPDHEESVEEFVRRNLGDEVFERLIEPFCSGVYAGDPSKLSM
KAAFGKVWKLEQKGGSIIGGTFKAIQEKNNTPKPLRDPRLPKPKGQTVGSFKKGLIMLPE
AISKRLGGKVKLSWKLSSIIRLDDGGYSLTYETPEGLVSLQSRSVVMTVPSRVASSLLHP
LSAVAADALSKFYYPPVAAVSISYPKEAIRTECLIEGELKGFGQLHPRSQGVETLGTIYS
SSLFPNRAPPGRILLLNYIGGATNPGILSKTESELVEAVDRDLRKMLINPNAKDPLVLGV
RVWPQAIPQFLIGHLDLLDAAKSALRDGGFQGMFLGGNYVSGVALGRCVEGAYEVAAEVA
DFLSQYVYK
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccctcaccctcgctgaccctcccactcttcgccttctttctcccgtaaatctc
cgccgctccacctccatcagctctccatttttctgtagaccgtctaggaacaattgcact
ggtccatggagagtccgatgtgccgtcgccggggagtctacaatttcttcctccaaggtc
ggcgacggaaataattactcgccggtggactgcgtcatcgtcggggcgggaatcagcggc
ctctgcatcgctcaagctctcgccaccaagcacggcgatgtgggcagcaatgtgattgtg
acagaggcgagagatcgcgttgggggcaatataaccaccatggagggggacggctatctc
tgggaggaaggccccaacagcttccagccctccgattccatgctcaccatggccgtggat
agtggtttgaaggatgatcttgttttgggggatcctaatgcacctagatttgtattgtgg
aatggtaaattgaggccggttccctccaagccaaccgacctgcccttctttgacttgatg
agttttcctggaaaactcagggctgggtttggtgcccttggcattcgacctcctccacca
gatcatgaggaatctgttgaagagtttgtgcgtcgtaatcttggtgatgaggtttttgaa
cgcctgatagagccattttgttcaggtgtttatgcaggagatccttcaaaactgagcatg
aaagcagcatttggaaaagtttggaagcttgagcagaagggtggtagtataattggtggc
accttcaaagcaatccaggagaaaaataatactcccaagcctctgcgagacccgcgtttg
ccaaagccaaaggggcaaacggttggatcttttaagaagggacttattatgttgccagaa
gcaatttctaaaaggttgggtggcaaagtaaaattatcttggaaactttcaagcatcatt
agattggatgatggagggtatagtctgacttatgaaacaccagaaggattagtttctctg
cagagtagaagtgttgtgatgactgttccatcccgcgttgcaagtagtctgttgcatcct
ctttctgctgttgctgcagatgcactatcaaagttttactaccccccagttgcggcagtg
tccatttcatatccaaaggaagcaattcggacagaatgcttgatagaaggtgaacttaag
ggatttggccagttacatccacgtagccaaggggtggaaactttaggaaccatatacagc
tcatcactttttcctaaccgagcaccgcctggaaggattttgctcttgaactacattgga
ggggctaccaatcctggaattttgtccaagacagagagtgaacttgtggaagcagtagac
agagatttgaggaagatgctcattaatcctaatgcaaaggatccacttgttttgggtgtg
agagtatggccgcaggccattccacagtttttgattggtcatcttgatctccttgatgct
gccaaatccgctctcagggatggtgggttccagggcatgttcctcgggggcaactatgta
tctggtgtagccttgggacgatgcgtggagggtgcatacgaagttgcagctgaggtagct
gatttcctatcgcagtatgtgtacaaatag

DBGET integrated database retrieval system