KEGG   Vitis vinifera (wine grape): 100243703Help
Entry
100243703         CDS       T01084                                 

Definition
phosphoinositide phospholipase C 2-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100243703
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100243703
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100243703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 564 aa AA seqDB search
MSERTKPPADIKDIFDRYSDHGTMTLDHLLRFLIEVQGEKAATKDDAEAIVNALIALQHP
DISQSKALDLQAFFWYLFGDVNPPLSPSGSHDMNAPLPHYFIYTSHNSYLTGNQLSSDSS
DAPIIEALQRGVRVIELDLWPNSTEDDVDVLHGMTLTNPVKLIQCLRSIKEYAFVVSDYP
VVITLEDHLKPDLQAKVAQMLTQTFGDMLFVPESECIAEFASPEALKRRILISTKPPKEY
LEKKIEIIKIYFIPNLRITIXKQNDPENVESIDREDLEDEEDEEDKLQHNAAPEYRRLIA
IHAGKLKGGLKEWLRVDPDKVRRLSLSERELEKASITHGKDIIRFTQKNFLRVYPKGVRV
DSSNYDPLTAWMHGAQMVAFNMQGYGKSLWLMQGMFRANGGCGYVKKPDFLLKLGPNNDV
FDPQANLPVKTTLKVKAYLGEGWHSDFGKFDIYSRPDFYLRVGIAGVPEDSGMKETKEMD
DNWNPTWNEEFEFPLTVPELALIRIEIYDYDMSERDDFGGQTCLPVSDLKTGIRAVPLHN
KEGDKYKSVKLLMRFEFVSVDSRP
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcgaaccaaacccccggcggacatcaaggatatattcgaccgttactccgac
cacggaacaatgaccctcgatcacctcctcaggttcctgatagaagttcagggcgaaaaa
gcggccaccaaggacgatgcggaagccattgtcaatgccctcattgctctccagcatccc
gacatctctcaatccaaggctctggatctccaagcctttttctggtacctcttcggcgac
gtcaatcctcccctctcgccttccggctcgcatgacatgaatgctccgttgccgcattat
ttcatctatacaagtcacaattcctatctaaccgggaatcaactcagcagtgactccagc
gatgcccccattatagaagcactgcagagaggtgtaagagtaattgaactggatctgtgg
ccaaattccaccgaagatgatgtggatgtccttcatggcatgacactaacaaacccggtg
aaactcatccagtgtttgagatctatcaaggaatatgcttttgttgtgtctgattatcct
gttgtaataactttagaagaccacctcaagccagatcttcaggctaaagtggcccagatg
ctcactcaaacctttggagatatgctgtttgtccctgagtcagaatgtatagcagaattc
gcttcacctgaagcattgaagagacggatcctaatctcaaccaaaccaccaaaagaatat
cttgaaaaaaaaattgaaattattaaaatttacttcatccctaatctcagaattaccatt
tgaaaacagaatgacccagagaatgtagagtctattgacagggaagatcttgaagatgag
gaagatgaggaagacaagttacaacacaatgctgcacctgaatataggcgtctaattgcc
attcatgctgggaagctaaaaggtggactgaaagagtggctgagggtggatcctgataaa
gttaggcgtcttagcttaagtgagcgtgagcttgaaaaggcatccataactcatggtaaa
gatattatcaggtttacccagaaaaatttcctgagagtatatccaaaaggtgtacgggtt
gattcatcaaattatgatccgctaactgcatggatgcatggagctcaaatggtggcattt
aatatgcagggatacggcaagtcactttggttgatgcaaggaatgttcagagccaatggt
ggttgtggttatgtgaagaaacctgattttctactgaagcttggtcccaacaatgatgtt
tttgatcctcaagcaaatttaccagtgaagacaactttgaaagttaaagcatatttgggg
gagggctggcattcagattttggtaaatttgatatatattctcgaccagacttctatcta
agggttggaatagctggggttccagaagattcaggaatgaaggaaacaaaggaaatggat
gataactggaaccctacttggaatgaagagtttgagttccccttgactgttcctgagctg
gcattgatccggattgaaatatatgactatgatatgtctgagagggatgattttggaggt
caaacatgtcttcctgtttcagatttgaaaacaggaatccgggctgttccacttcacaac
aaagagggggataagtacaaatctgtaaagctactcatgcgcttcgaatttgtttcagtt
gattccaggccttga

DBGET integrated database retrieval system