KEGG   Vitis vinifera (wine grape): 100243788Help
Entry
100243788         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100243788
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100243788
Transcription machinery [BR:vvi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100243788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 596 aa AA seqDB search
MSSKINHHRINGQIPQPCPHLAEYRTRNGSKPFRALQECLRVKPLGRAAIRRDPSEVPRC
GACGEAARSRLYACVTCAAVSCHSSDSPSPSHAAAHAVSMPPGHEIAVDVDRAELFCCAC
RDQVYDRDFDAAVVVAQTTASTLGGGSIRSSPPPENLRKRRRVDYRPWTPDLRERVLMTR
NSSPLQRTEGADGANLSNLPWGLRGLNNLGNTCFMNSVLQALLHTPPLRNYFLSDRHNRY
YCQQKNNASNASKRNAASNDSNSNKNLRLCLACDMDAMFSAVFSGDRTPYSPAKFLYSWW
QHAANLASYEQQDAHEFFISMLDGIHEKMGKDKRKTQSQGNGECCIAHRVFSGILRSDVM
CMACGFTSTTYDPCVDISLDLEPNQGVSTKMGSTKSHHSCNGEADSMNSSQNCGTSTLMG
CLDRFTRPERLGSDQKFFCQQCQVRQESLKQMSIRKLPLVSCFHIKRFEHSSIRNMSRKV
DRYLQFPFSLDMAPYLSSSILRSRFGNRIFSFDGDEPDASNELSSEFELFAVVTHTGKLD
AGHYVTYLRLSNQWYKCDDAWITQVNENIVRAAQGYMMFYVQKMLYYKASEKPTPS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaagatcaatcaccaccggatcaacggtcagattccacagccttgtccacac
ctagccgaatacagaacccgaaacggctccaagccgttccgagccctacaggagtgcctc
cgtgtaaagccgctcggtcgggccgcgatccgccgcgaccccagcgaggtgcctcgatgt
ggcgcgtgcggcgaggcggcgaggtcgcgcctctacgcctgcgtgacttgcgcggcggtg
tcgtgccacagctcagactcgccttcaccgtcgcacgcggcggctcacgctgtgtcgatg
ccgcctgggcacgagatcgccgtggatgtagatcgcgccgagctattctgttgtgcgtgt
cgcgaccaggtctacgaccgggacttcgacgccgcggtagtggttgcgcagacgactgcg
tccaccctcggcggcggttcgatccgatcctctccgccgccggagaatttgaggaaaagg
aggagggtcgattatcggccttggacacctgatctgagggaacgagtcttgatgactcga
aactcgagtccattgcaaagaactgagggggctgatggtgcgaacttgtccaatttgcca
tggggattgagaggattgaacaatttgggaaacacttgttttatgaattcggtgttgcag
gcattgcttcacactcctccactgagaaactatttcttgagtgatcggcataatcggtat
tattgtcagcagaagaacaatgctagtaatgcatccaagcgcaatgctgctagcaatgat
agtaacagtaataagaatttgaggttgtgtttggcttgcgatatggatgccatgttttct
gctgtgttttccggagatcggacgccctatagccccgcaaaatttctttacagttggtgg
caacatgcagcaaacctagcaagttatgaacagcaggatgcacatgaatttttcatttcc
atgcttgatggcatccatgaaaagatgggaaaggataaacgcaagacccaaagccaaggc
aatggagaatgttgtattgctcatagagtattctctggtatcttgcgatctgatgtcatg
tgcatggcatgtggtttcacatctacaacgtatgacccatgtgtagacatctcattggac
ttggagccaaatcagggggtttcaacaaagatggggtcaacaaaatcccatcattcttgc
aatggtgaggcagactccatgaactcaagccaaaactgtggaacatcaaccctgatgggg
tgcttggaccggttcactagacctgagagattaggctctgatcagaaatttttctgccaa
cagtgtcaggtgagacaggaatctctcaagcagatgtccataagaaagcttcctttggtt
tcatgcttccacatcaaaaggtttgaacattcttccatccgaaatatgtcaaggaaagta
gaccgctatctccagttcccattttcgttggacatggcaccttatctctcttcctccata
ttgaggagccggttcgggaacaggatattctcctttgatggggatgagccagatgcatca
aatgagttatcatcggagtttgagttgtttgctgttgtcactcacacaggtaaactagat
gctggccattatgtgacatatttgcgattaagtaatcagtggtataagtgtgatgatgct
tggatcactcaagttaatgagaacattgtgagggctgcgcaaggatacatgatgttctat
gtacagaagatgctttattacaaagcaagtgaaaaaccaaccccctcttga

DBGET integrated database retrieval system