KEGG   Vitis vinifera (wine grape): 100243811Help
Entry
100243811         CDS       T01084                                 

Definition
(RefSeq) polyprenol reductase 2
  KO
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100243811
    1.3.1.94  polyprenol reductase
     100243811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 342 aa AA seqDB search
MEGDGRMEVGLAWLLRAAWIAGTLPILVASIPSSRLSPVHGVLSGFASRGKTLQSSSQKL
TVPQSFFSHFYLVAVVWTTILLLATWYYAYKMAPLDSVSLDYSTIASHLTGGSHILSLHK
SRSTSAQHRYRVWRPVFLLLLMELHVMRRLYETLYVFNYSSSARMHIFGYLTGLFFYIAA
PLSLCTCCAVEVFNFTADQVAEINVEGRDLLSITGSDWWGYVKPITKLGWFEWIGAAIFI
WGWVHQCRCHAILGSIRKERTGEYRIPHGDWFELVSSPHYLAEMVIYAGLLVASGAADFT
IWLLFVFVVANLGFAAAETQRWYLHKFEDYPRKRRACLPYIY
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtgatgggagaatggaggtgggactcgcttggcttctgagagcggcgtggatt
gcgggaacattgcccatattggtcgcttcaatcccttcttctcggctcagtcccgtccat
ggagttttgtcaggattcgcaagtagaggcaagactctgcaatcttcgtcccaaaagttg
acggtgccacagagttttttctcgcatttttacttggtggccgtggtgtggacgacaatc
ttgctacttgcaacatggtactatgcatataaaatggcaccattggattctgtgtcattg
gattactccaccattgccagccacttgactggaggttcccatatactttcactgcacaag
tctcgttctacctctgcacagcacagatacagggtatggagacccgtgtttttgctttta
ttgatggaactgcatgtcatgaggcgtttatatgagacgctatatgtctttaactacagc
agttcagcccgaatgcacattttcggctatctaactggcctttttttctatatagcagca
cccctttctctttgcacctgttgtgctgtagaggtttttaactttacagctgatcaagtg
gctgagatcaatgttgaaggcagagatttgttgtcaatcactgggtctgattggtgggga
tatgtgaagcctattacaaaacttggatggtttgagtggattggtgcagctatattcatt
tggggctgggttcatcaatgccgatgtcatgcaattcttggctcaatacgaaaagaaaga
actggtgaatatcgaattcctcatggtgattggtttgaacttgtttcaagtccacattac
ttggcagagatggttatatatgcaggcttattggttgcaagtggggcagctgacttcact
atttggctactttttgtatttgtggtggcaaatctgggctttgcagctgcagaaacacaa
aggtggtacctccataagtttgaggactatccacgcaaacgccgtgcttgtcttccatat
atctactag

DBGET integrated database retrieval system