KEGG   Vitis vinifera (wine grape): 100244016Help
Entry
100244016         CDS       T01084                                 

Definition
(RefSeq) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00790  Folate biosynthesis
vvi01100  Metabolic pathways
Module
vvi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100244016
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100244016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-GeneID: 100244016
NCBI-ProteinID: XP_002266199
UniProt: F6HJF9
Position
3
AA seq 455 aa AA seqDB search
MGALDEGHFSVELEDGVNVEVGFEPETLPIEEAVKVLLQGLGEDINREGIRKTPARVAKA
LCEGTRGYRQKAKDIVQGALFPEAGLDEGVGHAGGVGGLVIVRDLDLFSYCESCLLPFQV
KCHVGYVPSGQQVVGLSKLSRVADVFAKRLQDPQRLADEVCSALNHGIKPTGVAVVLQCL
HIHFPNLELGFLDSTHQEWVKVSVCSGKGLFENSKATIWSDFLSLLKFRGMNVEKTRTKD
STSPCWCPSQSSSALIPCKIELVHQMDAAVTSILKSLGEDPSRKELVRTPNRYVRWLMNF
EKANLELKLNGFVCGKMDPFHPSCNEAEMQSELNLAFWSLCEHHLLPFHGVVHIGYFCTK
GTNPIARSILESIVHFYGFKLQVQERLTRQVSETVSSLLGGDVIVVVEASHSCMVSRGIE
KLGSNTATMALLGRFSTDAAAKNMFLQSIQNTSTS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggggctttggatgaggggcactttagtgtggaactggaggatggcgtgaatgtggag
gtgggatttgagccagagactctacccattgaggaggctgttaaagtgcttctgcagggt
ttgggtgaggatatcaatagggaaggcatccgtaagacccctgcccgtgttgccaaggcc
ctttgtgaaggaactagaggttacaggcaaaaggcaaaagacattgttcaaggtgcctta
ttccctgaagctggtttggatgagggagttggtcatgcaggaggagtgggcgggctcgtg
attgttcgagatcttgatctcttctcatactgtgaatcttgtttgcttccattccaggta
aagtgtcatgtgggttatgtcccatcagggcaacaggttgtgggcttaagtaagctttct
cgggtagctgatgtttttgcaaaacgactccaagatccacagcgtctcgcagatgaagtg
tgttctgctttgaaccatgggatcaagcctacaggtgttgctgttgtactccagtgttta
catattcatttcccgaatttagagttgggcttccttgattcaacccatcaagagtgggtc
aaagtatcggtttgttccggtaaaggcctttttgaaaattcgaaggccaccatttggagc
gattttttaagtctcctgaaattccgaggcatgaatgtggagaaaacccgtaccaaagat
tccacaagtccatgttggtgcccatcccagtcctcctctgctttaattccatgcaagata
gaacttgtccaccaaatggatgctgcagtaacttcaattctcaagtctttgggtgaagac
ccatcgaggaaagagctggtacgaacccctaatcgttatgtgaggtggctgatgaacttt
gaaaaagctaacttggagctgaagctaaatgggtttgtttgtggtaagatggatcctttt
catcccagttgcaacgaggcagagatgcagtctgagctgaacttggcattctggtctctg
tgcgagcatcatttacttcccttccatggtgttgtgcatataggctacttctgcaccaaa
ggaaccaatcccattgcaagatccattttagagtcaatagtacatttctatggcttcaag
ctccaagtacaggaaaggcttaccaggcaggtttctgagactgtttcatctctgctaggt
ggagatgtgatagtggtggtggaagctagtcactcgtgcatggtctccagaggaatcgag
aagttaggaagtaatactgctacaatggctctgcttggccggttttcaaccgatgctgct
gcaaaaaacatgtttttgcagagcattcaaaacacttcaacttcttga

DBGET integrated database retrieval system