KEGG   Vitis vinifera (wine grape): 100244395Help
Entry
100244395         CDS       T01084                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 1, mitochondrial
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00020  Citrate cycle (TCA cycle)
vvi00310  Lysine degradation
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
vvi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100244395
  Amino acid metabolism
   00310 Lysine degradation
    100244395
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100244395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 PYNP_C RnfC_N HlyD_D23 HlyD_3 GCV_H
Motif
Other DBs
NCBI-GeneID: 100244395
NCBI-ProteinID: XP_002266593
UniProt: F6H7I5
Position
10
AA seq 473 aa AA seqDB search
MWAIVRRKVASGSSAASVLGQSLSKIRPAAASVPRGYTTTAKEALLLGGGSKIIRNVGHY
KYLGSLVSSKPVREVTSFLQIDSPIQVQHRPFSSDKGDLVDAVVPFMGESISDGTLAKFL
KKPGDHVEVDEPIAQIETDKVTIDVASPEAGVVQKFVAKEGDVVEPGTKIAVISKSGEGV
THVAPSEKTPSKASPEPSPTEKEAVDKPKPKSETPPPKEKPKAPAPPPPRPSATEPVLPP
KERERRVPMTRLRKRVATRLKDSQNTFAMLTTFNEVDMTNLMKLRSDYKDAFLEKHGVKL
GLMSGFIKAAVSGLQNQPIINAVIDGDDIIYRDYIDISIAVGTPKGLVVPVIRNADGMNF
ADIEKAINTLARKANDGTISIDEMAGGSFTISNGGVYGSLLSTPIINPPQSAILGMHSIV
NRPMVVGGNVVSRPMMYIALTYDHRLIDGREAVFFLRRIKDVVEDPRRLLLDI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgattgtgaggcgaaaggttgcttctggaagctcggctgcttcggttttaggg
cagtcattgagtaagattcgacctgctgcggcatccgtaccgcgaggatacacaaccact
gcaaaagaggcattacttcttggaggaggatcaaaaattatacggaatgttggtcactac
aagtatctgggttctctagttagttcaaagcctgtgagagaagttacgtcatttcttcaa
atagattctccaatccaagtgcagcataggccattttcttcagacaaaggtgatctggtg
gatgctgttgtgccttttatgggtgaatctattagcgatggcactttggcaaaattctta
aagaaacctggtgaccatgtagaagttgatgagccaattgcccaaattgagactgataag
gtgacaattgatgttgcgagtcctgaagctggtgtggtccaaaagtttgtagccaaagaa
ggtgatgtcgtggagccaggtaccaagatagctgtgatttcaaagtctggtgaaggtgta
acacatgttgctccatcagagaagacgcctagcaaggcgtctcctgagccttctcctaca
gaaaaggaggcagtggataagccaaagcctaaatcagaaactcctcctcctaaggagaag
cctaaagcacctgcaccaccacctcctagaccttcagctacagaacctgtgcttcctccc
aaggagagggaaagaagagttcctatgacaagattaaggaaacgtgttgcaacacgtttg
aaagattctcaaaacacttttgcaatgctgaccacattcaatgaagttgatatgacaaac
ttaatgaagctccgttctgattataaagatgcttttcttgagaagcatggagtgaagttg
gggctgatgtctggatttattaaagctgctgttagtgggctccagaatcagcccatcatc
aacgctgttattgatggggatgacattatttatagagattacattgatatcagtattgct
gttggtacgcccaagggacttgtcgttccagtgattcgcaatgccgacggaatgaacttt
gctgatatagagaaggcgattaacactcttgcaaggaaggcaaatgatggcaccatatct
atcgatgagatggctggtggctcattcacaatatccaatggtggtgtctatggaagcctg
ttgagtaccccaatcatcaaccctccccagtcagctatcttgggaatgcactcaatagtg
aaccgtccaatggttgttgggggcaatgtcgtctcaaggccaatgatgtacattgcacta
acatatgaccacaggctgattgatggaagagaggcagttttcttcctgcgccgtatcaaa
gacgtcgtggaggatcctcggaggctacttcttgacatataa

DBGET integrated database retrieval system