KEGG   Vitis vinifera (wine grape): 100244395Help
Entry
100244395         CDS       T01084                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100244395
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100244395
  Amino acid metabolism
   00310 Lysine degradation
    100244395
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100244395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 473 aa AA seqDB search
MWAIVRRKVASGSSAASVLGQSLSKIRPAAASVPRGYTTTAKEALLLGGGSKIIRNVGHY
KYLGSLVSSKPVREVTSFLQIDSPIQVQHRPFSSDKGDLVDAVVPFMGESISDGTLAKFL
KKPGDHVEVDEPIAQIETDKVTIDVASPEAGVVQKFVAKEGDVVEPGTKIAVISKSGEGV
THVAPSEKTPSKASPEPSPTEKEAVDKPKPKSETPPPKEKPKAPAPPPPRPSATEPVLPP
KERERRVPMTRLRKRVATRLKDSQNTFAMLTTFNEVDMTNLMKLRSDYKDAFLEKHGVKL
GLMSGFIKAAVSGLQNQPIINAVIDGDDIIYRDYIDISIAVGTPKGLVVPVIRNADGMNF
ADIEKAINTLARKANDGTISIDEMAGGSFTISNGGVYGSLLSTPIINPPQSAILGMHSIV
NRPMVVGGNVVSRPMMYIALTYDHRLIDGREAVFFLRRIKDVVEDPRRLLLDI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgattgtgaggcgaaaggttgcttctggaagctcggctgcttcggttttaggg
cagtcattgagtaagattcgacctgctgcggcatccgtaccgcgaggatacacaaccact
gcaaaagaggcattacttcttggaggaggatcaaaaattatacggaatgttggtcactac
aagtatctgggttctctagttagttcaaagcctgtgagagaagttacgtcatttcttcaa
atagattctccaatccaagtgcagcataggccattttcttcagacaaaggtgatctggtg
gatgctgttgtgccttttatgggtgaatctattagcgatggcactttggcaaaattctta
aagaaacctggtgaccatgtagaagttgatgagccaattgcccaaattgagactgataag
gtgacaattgatgttgcgagtcctgaagctggtgtggtccaaaagtttgtagccaaagaa
ggtgatgtcgtggagccaggtaccaagatagctgtgatttcaaagtctggtgaaggtgta
acacatgttgctccatcagagaagacgcctagcaaggcgtctcctgagccttctcctaca
gaaaaggaggcagtggataagccaaagcctaaatcagaaactcctcctcctaaggagaag
cctaaagcacctgcaccaccacctcctagaccttcagctacagaacctgtgcttcctccc
aaggagagggaaagaagagttcctatgacaagattaaggaaacgtgttgcaacacgtttg
aaagattctcaaaacacttttgcaatgctgaccacattcaatgaagttgatatgacaaac
ttaatgaagctccgttctgattataaagatgcttttcttgagaagcatggagtgaagttg
gggctgatgtctggatttattaaagctgctgttagtgggctccagaatcagcccatcatc
aacgctgttattgatggggatgacattatttatagagattacattgatatcagtattgct
gttggtacgcccaagggacttgtcgttccagtgattcgcaatgccgacggaatgaacttt
gctgatatagagaaggcgattaacactcttgcaaggaaggcaaatgatggcaccatatct
atcgatgagatggctggtggctcattcacaatatccaatggtggtgtctatggaagcctg
ttgagtaccccaatcatcaaccctccccagtcagctatcttgggaatgcactcaatagtg
aaccgtccaatggttgttgggggcaatgtcgtctcaaggccaatgatgtacattgcacta
acatatgaccacaggctgattgatggaagagaggcagttttcttcctgcgccgtatcaaa
gacgtcgtggaggatcctcggaggctacttcttgacatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system