KEGG   Vitis vinifera (wine grape): 100244518Help
Entry
100244518         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 12-like
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100244518
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100244518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 1117 aa AA seqDB search
MTLMTPAPLDQQEDEEMLVPHSDLVEGPQPMEVVAQADASSAVENQPVEDPQTSRFTWTI
ENFSRLNTKKHYSEIFVVGGFKWRVLIFPKGNNVDHLSMYLDVADSATLPYGWSRYAQFS
LSVVNQIHNKYSIRKDTQHQFNARESDWGFTSFMPLSDLYDPGRGYLVNDTCIIEAEVAV
RKILDYWTYDSKKETGFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDMPSGS
IPLALQSLFYKLQYNDNSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGTV
VEGTIQQLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCRDVYASFDKYVEVERLEG
DNRYQAENHGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPLQLDLDR
ENGKYLSPDADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWFKFDDERVTKEDT
RRALEEQYGGEEELPQTNPGFNNTPFKFTKYSNAYMLVYIRESDKEKIICNVDEKDIAEH
LRIRLKKEQEEKEDKRKYKAQAHLFTIIKVARDEDLAEQIGKDIYFDLVDHDKVRSFRIQ
KQWPFTLFKEEVAKEFGIPVQYQRFWIWAKRQNHTYRPNRPLTPQEEAQSVGQLREVSTK
VNNAELKLFLEVELGPDLRPIPPPEKTKEDILLFFKLYDPEKEELRYVGRLFVKSSGKPI
EILTKLNEMAGFAPDEEIELYEEIKFEPCVMCEHLAKRTSFRFSQIEDGDIICFQKSAPP
ESEEQCRYSDVTSFLEYVQNRQVVHFRALERPKEDDFCLELSKLHNYDDVVERVARRLGL
DDPSKIRLTSHNCYSQQPKPQPIKYRGVEHLSDMLVHYNQSSDILYYEVLDIPLPELQGL
KNLKVAFHHATKDDVIIHNIRLPKQSTVGDVINELKTKVELSHPNAELRLLEVFYHKIYK
IFPPSEKIENINDQYWTLRAEEIPEEEKNLGPHDRLIHVYHFTKETVQNQMQVQNFGEPF
FLIIHEGETLAEVKERIQKKLQVPDEEFSKWKFAFLSLGRPEYLQDSDIVSSRFQRRDVY
GAWEQYLGLEHSDTAPKRAYAANQNRHTFEKPVKIYN
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atgactctcatgactcctgcgccattggatcagcaagaagatgaggagatgctcgttccc
cattcggatttagtcgaaggtcctcagcccatggaagtggtggcgcaagcagatgctagt
agtgctgtggagaatcagcccgtggaggatcctcagacatctagattcacatggacaatt
gagaacttttctaggttgaacaccaagaagcactattccgagatattcgtcgttggtggt
tttaaatggcgggtgcttatttttccaaaaggaaacaacgtagaccacttgtcaatgtat
ttagatgttgcagattctgcaaccttaccatatgggtggagtcgttacgcacaattcagc
ttgtctgttgttaatcagattcataacaaatactcaataagaaaggacacacagcaccaa
ttcaatgcgagagagagtgattggggcttcacatcattcatgcccctcagcgatctttat
gaccctggtagagggtaccttgtgaatgatacatgtataattgaagctgaggttgctgtt
cgtaagattctagattactggacttatgattcaaaaaaggagactggttttgttggactg
aagaaccaaggggctacttgttacatgaattctctcttacaaactctctaccatattcct
tatttcagaaaggctgtgtaccatatgccaactacagagaatgatatgccttcaggaagc
attccattggctctgcagagtttattttataagctccagtataatgacaacagtgttgca
actaaggaattgacgaagtcctttggatgggacacatatgattcttttatgcagcatgat
gtgcaagaacttaatagagttttatgtgaaaagcttgaggataagatgaagggaactgta
gtggaggggacaatacagcagttgtttgaagggcaccatatgaactacattgagtgcatc
aatgtggactacaaatctacaagaaaggaatcattttatgacctacaacttgatgtaaaa
ggatgccgggatgtttatgcttcttttgacaagtatgtagaagttgaacgtcttgaaggt
gataacagataccaagctgagaatcatggtttacaggatgctaagaagggtgtcttattt
attgacttcccaccagttcttcaacttcagctaaagcggtttgagtatgacttcatgcgg
gacactatggtgaagataaatgaccgttatgaattccctcttcaacttgaccttgataga
gagaatggaaaatatttgtcacctgacgcagataggagtgttcgcaacctttacacactt
cacagtgttttggttcatagcggtggtgtgcatggtggacattattatgcttttatcagg
ccgaccctttctgatcagtggttcaaatttgatgatgagcgggtaaccaaagaagatact
aggagggcattggaggaacagtatggtggcgaggaagagttgccacagacaaaccctgga
ttcaacaacactccatttaaattcacgaaatactcaaatgcatacatgcttgtgtatata
cgtgaaagtgacaaggagaaaatcatttgtaatgtggatgagaaggacattgctgaacac
cttaggataaggttgaagaaagaacaagaagagaaggaggataagagaaaatataaagca
caagcccacctttttactattataaaggttgcacgggatgaagaccttgcagagcaaatt
ggaaaggatatatattttgatcttgtggatcatgacaaagtccgcagttttcgcattcag
aaacagtggccttttacccttttcaaggaggaagtggccaaagagtttggtattccagtc
caatatcaacgattttggatttgggcgaagcggcaaaaccatacttatcgtcccaataga
ccattgacaccccaagaggaagcacagtctgttgggcagttgagggaggtatcaactaaa
gtgaacaatgcagaactaaagttgtttttggaagttgaacttgggccggatctgcgtcct
attcctccacctgaaaaaactaaagaagatattctgcttttcttcaagctttatgaccct
gagaaagaagagctccgatatgttggtagactttttgtgaagagttctggtaaaccaata
gagattctaacaaaactaaatgaaatggctggatttgctcctgatgaagagattgaactc
tatgaggaaataaaatttgagccttgtgtcatgtgtgaacacctcgctaagaggacatca
tttcgatttagccagattgaagatggggacatcatttgcttccagaaatctgctcctcct
gaaagtgaagaacaatgccggtattctgatgtcacttcatttttggaatatgtgcaaaat
cgtcaggttgtgcattttcgagctttggagagacctaaggaggatgatttctgtctagag
ttgtcaaagctacacaattatgatgatgttgtggaaagagtggctcgtagacttggtttg
gatgatccatccaaaatcagacttacatctcacaactgctattcccagcaacctaagccc
caaccaattaaatatcgaggtgtagagcatttgtcagacatgcttgtgcattacaatcag
agttctgatattttatattatgaagttctagacatccctcttccagaattgcaaggtctg
aaaaatctgaaagttgcttttcatcatgctacaaaggatgatgtgataattcacaatatt
agattgcctaaacagagtactgttggagatgtgattaatgaacttaagacaaaggttgag
ttgtctcatccaaatgcagaacttagactgcttgaagttttctatcacaagatttataag
atctttccacccagtgaaaaaatcgagaatataaatgaccaatactggacactccgtgca
gaggagattccagaagaagagaagaatcttggtccccatgatcgcttgattcatgtttac
cacttcacaaaggagactgtacagaatcagatgcaagtacaaaattttggtgaacccttt
ttcttgatcatccatgaaggcgaaactcttgctgaagttaaagagcgcatacaaaagaaa
ttgcaggttccggatgaggagttttcaaagtggaagtttgcttttctatcactgggtcgt
ccagagtacctgcaggattctgacattgtgtccagccgttttcagagaagagatgtttat
ggtgcttgggaacagtaccttgggctggagcactctgatactgctcctaaaagggcttat
gcagcaaatcagaaccgccacacatttgagaagccggttaaaatatacaactag

DBGET integrated database retrieval system