KEGG   Vitis vinifera (wine grape): 100244762Help
Entry
100244762         CDS       T01084                                 

Definition
glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Class
Metabolism; Overview; Fatty acid metabolism [PATH:vvi01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:vvi00071]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:vvi00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 724 aa AA seqDB search
MGRTPKGRTVMEVGADGVALITLINPPVNSLSFDVLNSLKESYEEALRRDDVKAIVITGA
KGKFSGGFDITAFGGIQAGGEVSKPGFVSVEILTDTVEAARKPSVAAIDGLALGGGLEVA
MGCHARISTPNAQLGLPELQLGIIPGFGGTQRLPRLVGLSKALEMMLMSKPVKGVDAHSL
GLVDAVVAPDQLVKTARQWALDILECRRPWVHSLYKTDKLEPLGEAREILKFARTQAQKQ
APNLKHPLLCIDVIEAGIVSGPVAGLWKEAEAFQELLHSDICKSLVHIFFAQRGTSKVPG
IADLGLVPRRINKVAILGGGLMGSGIATALMLSNYPVILKEVNEKFLQAGIGRVRANLQS
RVKKGAMTQEKFEKTFSLLKGVLDYESFKDVDMVIEAVIENVSLKQQIFADLEKFCPPHC
ILASNTSTIDLNLIGEKTRSHDRIVGAHFFSPAHVMPLLEIVRTQRTSPQVIVDLLDIGK
KIKKTPVVVGNCTGFAVNRMFSPYTQAALLLVEHGADVYQIDRAITKFGMPMGPFRLVDL
VGFGVAIATGGQFVQNFPERTYKSMLIPIMQEDKRAGETTRKGFYVYDDKRKASPDPELK
KYVEKARGISGVAIDPKLMKLSDKDIVEMIFFPVVNEACRVYAEGIAVKAADLDIAGVMG
MGFPPYRGGIMFWADSLGSKYIYSRLEAWSNLYGGFFKPCAYLAERAAKGAPLSSPLERA
KPRL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgggtaggactcccaagggaagaacagtgatggaggttggagctgatggggttgctctc
atcacccttatcaaccctcctgtcaattccctctcttttgatgtgctaaacagcttaaaa
gagagttatgaggaagccttacgtagagatgatgttaaggcaattgttattacaggtgca
aaaggaaagttttctggtggttttgatatcacagcttttggtggaatccaagctggaggt
gaagtttcaaagcctggttttgtatcagtagaaattctcaccgacactgtagaagctgca
aggaaaccttcagttgctgctattgatggccttgccttgggtggaggattagaggttgca
atgggctgccatgcacgaatatctactcctaatgctcaactaggccttcctgaacttcag
cttggaataattccaggatttggaggaacccagcgacttccacgccttgttggcctctca
aaagcccttgaaatgatgttgatgtcaaagccagttaaaggagtggacgctcatagtttg
ggccttgtggatgctgtagttgctccagatcagttagtaaagactgctcgccaatgggcc
ctagatattttagagtgtagaagaccatgggttcatagtctttacaagaccgacaagttg
gagcccctaggggaagcaagggagatactcaagtttgcaagaactcaggcacagaaacag
gctccgaatttgaagcacccattactttgcattgatgttattgaagcgggtatagtttct
ggtcctgttgctggactttggaaggaggctgaggcttttcaagaacttctacactctgac
atttgcaagtccttggtccacatcttcttcgctcaacgaggaacctcaaaggttcctggg
atcgctgatctgggtttggtaccaagacgaataaacaaagttgctattcttggtggagga
ttgatgggatctggaattgcaacagcattgatgcttagtaattatcctgtgatcctgaag
gaagtaaatgaaaagttcttacaggctgggattggtagagtccgagctaatttgcaaagc
cgtgtcaagaaaggggcaatgactcaagagaaattcgaaaaaaccttctctcttctcaag
ggtgtccttgattacgagagctttaaagatgtagacatggtcatagaggcggtcattgag
aatgtctctctaaagcaacaaatttttgcggatcttgaaaaattttgcccaccacattgc
attcttgcaagtaacacttcgacaattgacttaaacctgattggtgaaaagaccaggtcc
catgaccggattgttggagcccatttctttagtcctgctcatgtgatgccactgttggaa
attgttcgcactcagagaacatctccccaagtaattgttgatttactagatatcggaaag
aagataaagaaaacccctgttgtggttggcaattgcaccggttttgctgtcaacaggatg
ttttctccttacacacaggctgctcttttgctcgttgaacatggtgcagatgtctatcag
attgatagggcaattaccaaatttggaatgccaatgggcccattcagattggttgactta
gttggttttggtgtggcaattgcaactggcggacagtttgttcagaattttcctgagcga
acctataaatcaatgctaatcccaatcatgcaagaggataagagagcaggtgaaactact
cgcaaagggttctatgtatatgatgataaacgtaaagcaagcccagatcctgaactgaag
aagtatgttgaaaaggcaaggggcatttctggtgttgccattgaccctaagctaatgaaa
ttatctgataaagacattgtggagatgatattcttccctgtggtgaatgaggcatgccga
gtctatgctgagggtattgcagtcaaagcagcagaccttgacattgctggtgttatgggc
atgggtttccctccttacaggggaggaatcatgttctgggccgattctcttggatccaag
tacatctattcaaggttggaggcatggtcaaatctgtatggtggcttcttcaagccttgt
gcatacttggccgaaagagctgccaagggagctcctctgagttccccactggagcgagca
aaacctcgactgtaa

DBGET integrated database retrieval system