KEGG   Vitis vinifera (wine grape): 100244767Help
Entry
100244767         CDS       T01084                                 

Definition
SAL1 phosphatase-like
Orthology
K15422  
3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100244767
  Energy metabolism
   00920 Sulfur metabolism
    100244767
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100244767
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100244767
    3.1.3.57  inositol-1,4-bisphosphate 1-phosphatase
     100244767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 393 aa AA seqDB search
MGLGHPRADTDAITQINGLVSFHHSAIPKITKPSLFSQFPKVVSSMSYHKELAAAKKAAS
LAARLCQKVQKALLQSDVQSKSDKSPVTVADYGSQAVVSFILQRELPSESFSLVAEEDSG
DLRKDGAQETLARITELVNDTLTSDGTCISRVSEEDVLTAIDSGKSEGGSNGQHWVLDPI
DGTKGFLRGDQYAIALALLDEGKVVLGVLACPNLPLASIGGQDQHSLHNQIGCLFSAKIG
EGTDMQPLDGSSPIKVHVSAIENPEEASFFESFEAAHSKHDLSSSIAKKLGVKAPPVRID
SQAKYGALSRGDGAIYLRFPHKGYREKIWDHAAGCIVVTEAGGEVSDAAGNPLDFSKGRY
LDLETGIIVTNKKLMPSLLKAVRECLDEKPSSL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgggccttgggcacccaagagcagatacagatgccatcacgcaaatcaacggacttgta
tcttttcatcattccgccattcctaaaattacaaaaccctcactcttctctcagtttccc
aaagtggtttcctccatgtcttaccacaaagaactcgctgctgccaagaaagctgcctct
cttgctgctcgcctttgccagaaagtgcaaaaggcgctgttgcaatcagatgtccaatct
aaatcagataaaagccctgtcacagtggctgactatggctcacaggctgtagttagtttt
atactgcagagagaacttccatctgaatctttctcattagtggctgaggaggattcggga
gatcttcgcaaggatggtgcccaagaaacactagcacgcattactgaacttgtgaatgat
actcttaccagtgatgggacatgtatatctcgtgtatctgaggaagatgttcttactgcc
attgactctggtaaatctgaaggcggttctaatggccaacactgggttttggatcctatt
gatggcaccaaaggttttctaagaggagaccagtatgcaatagcattagcactgctagat
gaaggaaaagtggtgttgggtgtcctcgcttgtccaaatcttcccttggcatccattggt
ggtcaagatcagcattctttacacaaccaaattggctgccttttctctgctaaaattggc
gaaggaactgacatgcagccattagatggttcttcaccaataaaggtgcatgtcagcgcc
attgaaaaccccgaggaagcatcattctttgaatcatttgaagcagcacactcaaagcat
gacttgtctagctccatagcaaagaaacttggagtcaaagcacccccagttagaattgat
agccaggcgaagtatggggctctatccagaggagatggggccatttatcttcgcttccct
cataaaggatatcgtgaaaaaatatgggatcatgctgctggatgcattgttgtgacagaa
gctgggggtgaggtgtcagatgcggctgggaacccattagatttttctaagggaagatat
cttgatctggagacaggcatcattgtcacgaataagaagttgatgccatcgctattgaag
gcagttcgagagtgtcttgatgagaaaccttcctcattgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system