KEGG   Vitis vinifera (wine grape): 100244767Help
Entry
100244767         CDS       T01084                                 

Definition
SAL1 phosphatase-like
Orthology
K15422  
3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:vvi00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:vvi00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:vvi04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 393 aa AA seqDB search
MGLGHPRADTDAITQINGLVSFHHSAIPKITKPSLFSQFPKVVSSMSYHKELAAAKKAAS
LAARLCQKVQKALLQSDVQSKSDKSPVTVADYGSQAVVSFILQRELPSESFSLVAEEDSG
DLRKDGAQETLARITELVNDTLTSDGTCISRVSEEDVLTAIDSGKSEGGSNGQHWVLDPI
DGTKGFLRGDQYAIALALLDEGKVVLGVLACPNLPLASIGGQDQHSLHNQIGCLFSAKIG
EGTDMQPLDGSSPIKVHVSAIENPEEASFFESFEAAHSKHDLSSSIAKKLGVKAPPVRID
SQAKYGALSRGDGAIYLRFPHKGYREKIWDHAAGCIVVTEAGGEVSDAAGNPLDFSKGRY
LDLETGIIVTNKKLMPSLLKAVRECLDEKPSSL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgggccttgggcacccaagagcagatacagatgccatcacgcaaatcaacggacttgta
tcttttcatcattccgccattcctaaaattacaaaaccctcactcttctctcagtttccc
aaagtggtttcctccatgtcttaccacaaagaactcgctgctgccaagaaagctgcctct
cttgctgctcgcctttgccagaaagtgcaaaaggcgctgttgcaatcagatgtccaatct
aaatcagataaaagccctgtcacagtggctgactatggctcacaggctgtagttagtttt
atactgcagagagaacttccatctgaatctttctcattagtggctgaggaggattcggga
gatcttcgcaaggatggtgcccaagaaacactagcacgcattactgaacttgtgaatgat
actcttaccagtgatgggacatgtatatctcgtgtatctgaggaagatgttcttactgcc
attgactctggtaaatctgaaggcggttctaatggccaacactgggttttggatcctatt
gatggcaccaaaggttttctaagaggagaccagtatgcaatagcattagcactgctagat
gaaggaaaagtggtgttgggtgtcctcgcttgtccaaatcttcccttggcatccattggt
ggtcaagatcagcattctttacacaaccaaattggctgccttttctctgctaaaattggc
gaaggaactgacatgcagccattagatggttcttcaccaataaaggtgcatgtcagcgcc
attgaaaaccccgaggaagcatcattctttgaatcatttgaagcagcacactcaaagcat
gacttgtctagctccatagcaaagaaacttggagtcaaagcacccccagttagaattgat
agccaggcgaagtatggggctctatccagaggagatggggccatttatcttcgcttccct
cataaaggatatcgtgaaaaaatatgggatcatgctgctggatgcattgttgtgacagaa
gctgggggtgaggtgtcagatgcggctgggaacccattagatttttctaagggaagatat
cttgatctggagacaggcatcattgtcacgaataagaagttgatgccatcgctattgaag
gcagttcgagagtgtcttgatgagaaaccttcctcattgtaa

DBGET integrated database retrieval system