KEGG   Vitis vinifera (wine grape): 100244786Help
Entry
100244786         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 236 aa AA seqDB search
MATPDESSSAKKWLPLEANPDVMNQFLWGLGLLEDEAECYDVYGLDEELLAIVPKPVLAV
LFLYPITTQSEEERILQDSTKRETSNKVYFMRQTVGNACGTIGLLHAIGNVTSEIKLVEG
SFLNRFFKSTASMDPLERAAYLENDQEMEVSHSVAATAGDTEASTNADAHFICFSCVDGE
LYELDGRKSGAVSHGPSSPSTLLQDAAKVIQGIIQKNPDSINFNVIAISKKLEGPY
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaccagatgaaagttcttctgctaagaagtggcttcctctcgaagctaacccc
gatgttatgaaccagttcctttggggtcttgggcttttggaagatgaagcagagtgttat
gatgtttatggtctggatgaagaactcttagcaattgttccaaagcctgtccttgctgtg
ctgtttctttatcccattactacacagagtgaagaggagagaatcctgcaggatagtaca
aaaagggagactagcaataaagtttacttcatgagacaaactgtggggaatgcttgtgga
acaattggacttctccatgctattgggaatgtcacttcagagattaagcttgttgaggga
tcgttcttgaataggtttttcaaatccactgcaagcatggacccactagagcgtgcagca
taccttgagaatgaccaagaaatggaagtttctcattcggtagcagctactgctggtgat
acagaggcttcaactaatgcggatgctcattttatctgcttctcatgtgtggatggagaa
ctttatgaacttgatggacggaagtcaggagcagtatcacatggtccatcctcgcccagt
accttattgcaggatgcagccaaggtcatacagggtataatccaaaaaaatcctgactcg
atcaacttcaatgtcatcgcaatttcaaagaaacttgagggaccctactaa

DBGET integrated database retrieval system