KEGG   Vitis vinifera (wine grape): 100245360Help
Entry
100245360         CDS       T01084                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase 1-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vvi01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vvi00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:vvi00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:vvi00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 382 aa AA seqDB search
MASRFLSLPETDQVLFEESPGVRKMILNRPNKLNSLSYEMITQILRKLEVYENDPTVKLL
ILKGQGKVFCSGGDVVAMVLSIYGGHWSFGESFYRKQITLDYLFATSEKTLVSLINGIVM
GGGVGLSMNSRFRVVTENTVFAMPEAQMGHFPDVGVSYFLSRLPGFFGEYLGLTGAQLNG
TEMLACGLATHFVLSKDLLLLETALSEAASDTSTIPKVINRFARKTFLKQDSAFMRLEII
NKCFSAKTVEEILLLLQNEVANGSDAWIIEAISSMKSASPTSLKITLRSIREARMQELED
CLVRDYFICYHIIQGIHSIDFLEGSRTKLFEKGKKPKWEPSKLELVSDEMVDHYFAKVEA
PDIEHLRLPARKNIPKALESKL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccggttcttgtccttaccagagactgaccaggttctttttgaagaaagccca
ggtgtgcgaaagatgatactaaatagacccaacaagttaaatagtctctcttacgaaatg
atcactcaaattttgaggaaattggaagtttatgagaatgatcctacagtcaagctgttg
attctaaagggacaaggaaaagttttttgttcaggtggagatgttgttgctatggtctta
tctatatatggaggacattggagctttggtgaaagtttttacaggaaacaaatcacctta
gactacttgtttgctacttctgaaaagaccctggtttcacttattaatgggattgtaatg
ggtggaggtgttggattgtccatgaattcaaggtttcgagttgtgactgagaacacggta
tttgctatgccagaagcacaaatgggacattttccagatgttggtgtatcgtatttcctt
tctaggctcccaggattctttggagaatatttagggcttactggtgcacagctcaatgga
actgaaatgcttgcttgtggtcttgcaactcactttgtcctttcaaaggatctcctttta
ttggaaactgcactgtctgaggcagcttcagatacttcaaccattcccaaggttatcaat
agatttgcaaggaaaacattcctaaaacaagatagtgcttttatgagattggagattatc
aacaaatgtttctctgcaaaaacagttgaagaaatattgttattgctgcaaaatgaggtt
gcaaatggaagtgatgcttggatcattgaggcaataagctccatgaaatcagcttctccg
acaagccttaaaattactcttagatcgattagagaagcacgaatgcaagaacttgaggac
tgtttagtccgtgattattttatttgttatcacatcattcaagggatacacagcattgat
ttccttgagggttcaagaacaaaattatttgagaaaggcaaaaagcccaagtgggagcct
tcaaaactggagctagttagcgatgaaatggttgatcattactttgccaaagttgaagct
ccagatattgaacatttacgacttcctgctagaaaaaatatacccaaagcattggaatcc
aaactgtag

DBGET integrated database retrieval system