KEGG   Vitis vinifera (wine grape): 100245371Help
Entry
100245371         CDS       T01084                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase-like
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100245371
   01230 Biosynthesis of amino acids
    100245371
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100245371
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100245371
Enzymes [BR:vvi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100245371
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100245371
  Exosomal proteins of melanoma cells
   100245371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 345 aa AA seqDB search
MVAIAFHQTVGTLHSQGYLNNSGFHHEFGNASVKLIPRGSKVNVGLLKRGSGNSGKRSFA
VIQASTAHTSVSGPVSSPSSNSTNGSPKKSNETALILIRHGESLWNEKNLFTGCVDVPLT
RKGVEEALEAGMRISNIPIDMIYTSALIRSQMTAMLAMTQHRRKKVPIIMHNESEQAKAW
SQIYSEDTKRQSIPVIAAWQLNERMYGELQGLNKQETADRYGKEQVHEWRRSYDIPPPNG
ESLEMCAERAVAYFREHIEPQLLSGKHIMIAAHGNSLRSIIMYLDKLTSQEVISLELSTG
IPMLYIFKEGKFIRRGSPIGPAEAGVYAYTKSLAQYRQKLDDMLH
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggttgccattgcatttcatcaaaccgttgggaccctgcattctcaaggatatctcaat
aactctggttttcaccatgagtttgggaatgcttctgtgaaattgattccaaggggttcc
aaagtcaatgttggattattgaaaagaggaagtggcaattctggcaagagaagttttgct
gtaattcaagcctcaactgctcatacatcagtatccggtccagtgtcatcaccgtcaagt
aacagcactaatgggtcaccaaagaaatcaaatgaaactgctttgatcctaatccgacac
ggtgagtctttatggaatgaaaagaacctgttcactggttgtgttgatgtgcccttaact
aggaagggtgtagaagaggcacttgaagctggaatgagaatcagcaacattcccattgac
atgatctatacatctgctttaattcgctcacagatgactgctatgctagccatgacccag
caccgtcgcaagaaggtgccaatcattatgcataatgagagtgaacaggcaaaagcatgg
agtcaaatttacagtgaagacaccaaaaggcaatccataccagttatagcagcttggcaa
ttgaatgaaagaatgtatggagaattacagggtctcaataagcaggaaactgcagataga
tatggaaaggagcaggttcatgagtggcgtcgtagttatgatatacctccacccaatggc
gagagtttggaaatgtgcgctgaaagagctgtagcttattttagagaacatattgaaccc
caacttctgtctggaaagcacataatgattgctgcccatgggaattcactgaggtccatc
attatgtatctggacaaattaacttctcaagaggttattagcttagaactatcaacagga
attcccatgctttacatattcaaagagggaaaatttatcaggaggggaagtcctatagga
cctgctgaagctggggtttatgcctacactaagagtttggctcaatacaggcagaagttg
gatgatatgttgcattaa

DBGET integrated database retrieval system