KEGG   Vitis vinifera (wine grape): 100245397Help
Entry
100245397         CDS       T01084                                 

Definition
arginase-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100245397
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100245397
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100245397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 330 aa AA seqDB search
MRNIARKGIHYWQKLNAANVPAELIENGQNRVIDASLTLIRERAKLKGELVRALGGALAS
SSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNATTEEGKELNDPRVLTDVGDVPVQE
IRDCGVDDDRLMKIISESVKLVMEEDPLRPLVLGGDHSISFPVVRAVSEKIGGPVDILHL
DAHPDIYHSFEGNKYSHASPFARIMEGGYARRLLQVGLRSITSEGREQGKRFGVEQYEMR
TFSRDRHILENLKLGEGVKGVYISLDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLQA
DVVAADVVEFNPQRDTVDGMTAMVAAKLHF
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatattgcaaggaagggaattcattactggcagaaactgaatgctgcaaatgtc
ccagctgagttgatagaaaatggccaaaatcgtgttatagatgcttcccttactcttatt
cgtgagagggcgaagcttaagggggagcttgtgcgagctttaggtggtgctttagcctca
tcatctcttcttggagttcctctaggacataattcatcattccttcaagggccagccttt
gctcctcctcgtataagggaggcaatctggtgtggcagcacaaacgccacaactgaagaa
gggaaagaattaaatgatccacgggtgcttactgatgttggtgatgtccctgtccaagag
ataagagattgtggtgtagatgatgacaggttgatgaaaattataagtgagtctgtcaag
ctagtgatggaagaagatccattgcgcccattagttttaggtggtgaccactcaatatca
tttcctgttgtaagggctgtgtctgagaagattgggggtcctgtagatattcttcacctg
gatgcccatcctgacatttatcattcctttgaaggaaacaagtattcacatgcatctccc
tttgcccggatcatggagggtggttatgctcgacggcttttgcaagttggtcttcgatcc
attacaagtgaaggccgtgaacaaggcaagagattcggtgtggagcaatatgaaatgaga
acgttttcaagagatcgacacattttggagaacctgaaactaggggaaggcgtgaagggt
gtatacatttcattagatgtggactgtcttgatcctgcatttgctcctggggtatctcat
attgagccaggaggtctttctttccgcgatgttctcaacatcctccacaacctgcaagcc
gatgttgttgccgctgatgtggttgagttcaatccgcaacgtgacacagtggatgggatg
actgcaatggttgctgccaagctgcatttctga

DBGET integrated database retrieval system