KEGG   Vitis vinifera (wine grape): 100245687Help
Entry
100245687         CDS       T01084                                 

Definition
peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100245687
  Lipid metabolism
   00071 Fatty acid degradation
    100245687
   00592 alpha-Linolenic acid metabolism
    100245687
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100245687
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100245687
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100245687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 724 aa AA seqDB search
MSKAEVTMEVGNDGVAVITMSNPPVNALALAIIAGLKEKYAEAMRRNDVKAIVVTGKGGR
FSGGFDINVFQKVHKTADISHLPDASIDLLVNTVEDAKKPSVAAVEGLALGGGLEVAMAC
HARIAAPKTQLGLPELSLGVMPGFGGTQRLPRLVGLSKAIEMMRLSKSISSEEGYKLGLV
DAIVSSEELLKVSRRWALDIVDKRKPWVRSLHQTEKLGSVSEALDILKISRQQARKTVPH
LPQHQACLDVIEEGIVHGGYSGLLKETKVFNKLVLSDTAKGLIHVFFAQRATSKVPNVTD
IGLKPRNVKKVAVIGGGLMGSGIATALITSNIYVVLKEVNSEYLLKGIKTIEANVRGLVT
KGKLTQDKARKALSMLKGVLDYSEFKDIDMVIEAVIENISLKQKIFSEIEKICSPHCILA
TNTSTIDLNLVGEKTSSQDRIIGAHFFSPAHVMPLLEVVRTEKTSAQVILDLMTVGKAIK
KIPVVVGSCTGFAVNRTFFPYAQGAHFLVNLGVDPFRIDWVISNFGLPMGPFQLQDLSGY
GVAVAVGKEFATAFQGRTFESPLVNLLLKNGRNGKQNGKGYYIYEKGSKPRPDPSVLPII
EESRRLANIMPGGKPISVANQEILEMILFPVVNEACRVLDEGVVVRASDLDITSVLGMSF
PSYRGGIVFWADEVGPYYIYTCLKKWSAMYGTFFKPSSYLEQRATKGIPLSAPASASPAS
NSRL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggctgaagtaaccatggaggtcggaaacgatggcgttgcagtcatcaccatg
tccaatcctcccgtcaacgccttggcccttgcgattatcgcggggttgaaggagaaatac
gctgaggctatgaggagaaatgacgttaaagctattgttgttactggcaaaggtggaagg
ttttctggtggttttgacatcaatgttttccagaaagtacacaaaactgctgatatttcg
catttaccagatgcatctattgatcttttggtcaacacagttgaagatgccaagaagcct
agtgttgctgctgtggaaggacttgcccttggaggtggcttagaagtggcaatggcttgc
catgcacgtattgctgcaccaaaaactcaacttggcttgccagagctttcacttggagtt
atgcctggatttggaggcacacaacgtcttccaaggcttgtagggttgtcaaaggccatt
gaaatgatgcggttatccaaatcaatatcgtctgaagaagggtacaagctgggtcttgtt
gatgctattgtgtcttctgaagagttactgaaagtatctcgaagatgggctttggacata
gtggataagcgcaaaccttgggtgcgttcccttcaccagactgaaaagcttggatcagtg
tctgaagcacttgacattttgaaaatttccagacagcaagccaggaaaactgttccacat
ctgcctcagcaccaggcatgccttgatgtaattgaggagggcattgttcatggaggatat
agtgggcttctaaaggaaacgaaagttttcaacaagttagtcttgtcagacactgcaaaa
ggtcttattcatgtgttctttgctcagcgcgcaacatctaaggtacctaatgttactgac
attgggctcaaaccaaggaatgtaaagaaagttgctgtaattggtggaggtctaatgggt
tctggcatagctacagctctcatcacaagtaacatatatgttgtgctgaaagaagttaac
tctgaatatcttttgaagggtataaaaacgatagaagcaaatgttcgaggcttagtgaca
aaaggaaaactgacacaggataaagcacgtaaagccctctcaatgctcaaaggtgtactg
gactactcagaatttaaagatattgacatggtcatagaggctgtaattgaaaatatttca
ttaaaacagaaaatatttagtgaaatagagaagatctgttctccccactgcattttggca
acaaatacatctactattgacctcaatttagttggagaaaagaccagttcacaagatcga
atcataggggcgcatttcttcagccctgcacatgtgatgcctctcttagaagttgtacgt
acggagaagacttctgcacaagtaattcttgatctcatgacagttgggaaagccataaaa
aagattcctgttgttgtgggaagctgcactggttttgccgtcaatcggactttcttccca
tatgcacaaggtgcacattttttggtcaatttaggtgtggatccgtttagaattgactgg
gtaatcagcaattttggcctccccatgggccctttccagcttcaggacctttctggatat
ggagtagctgtagcagttgggaaagagtttgctactgcatttcaaggtcgcacatttgag
tctccattggttaaccttctactgaaaaatgggcggaatggtaaacagaatggaaaagga
tactacatatatgaaaagggaagcaagccaaggcccgatccttcagttctaccaattatt
gaggagtctagaaggcttgccaatattatgcctggtggaaagcctatatctgtggccaac
caagaaattctggagatgatactcttcccagtagtgaatgaggcatgccgtgttttggat
gaaggagttgttgttcgagcatcagacctcgacatcacatcggttcttggaatgagtttt
ccctcttaccgtggtggtattgtgttctgggcggatgaagttgggccttactatatatac
acatgtctcaagaaatggtcagctatgtatggcaccttttttaagccatcaagttatttg
gaacaaagagcaacaaaaggcataccattgagtgcacctgcttcagcttcaccagcttca
aattcacgtctctag

DBGET integrated database retrieval system