KEGG   Vitis vinifera (wine grape): 100245697Help
Entry
100245697         CDS       T01084                                 

Definition
phospholipid hydroperoxide glutathione peroxidase 1, chloroplastic-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100245697
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100245697
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100245697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 246 aa AA seqDB search
MASMPFSVSFTAHSPGFAQTKAAHHHSWPSSPYPSMAFLMPSTKSSFGASNSAFLRTGFS
LCSSEIPGVSLKSRFSGGVYARAATEKSLYDYTVKDIEKKDVPLSKFKGKVLLIVNVASK
CGLTASNYSELSHIYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKQFACTRFKAEFPIFD
KVDVNGPTTAPVYQFLKSNAGGFLGDLIKWNFEKFLVDKNGKVVERYQPTTSPFQIEKDI
QRLLAA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcttccatgcctttctctgtctccttcactgctcattcacctggatttgcccaaacc
aaagcagcacatcaccattcatggccttcttctccttatccttccatggctttcttgatg
ccatccaccaaatcctcttttggggcctctaattcagcctttttgcgaactgggttctcg
ctttgctcttcagaaattcctggggtctccttgaaatctcgattttcaggcggcgtttat
gcgagagcggctacggagaagagcctgtatgattacactgtcaaggatattgagaagaag
gatgttcctcttagcaaatttaagggcaaagtcctcttgatagtcaatgtggcttcaaaa
tgtggtttgacagcatcaaactattcagaactctcgcacatatatgagaagtacaaaact
caaggctttgagattctagctttcccttgcaatcagtttggggggcaagagcctggatca
aatcccgagattaagcagtttgcttgcacaaggttcaaagctgaattcccaatttttgat
aaggttgatgttaatgggccaaccactgctccagtttaccagtttctgaagtcaaacgct
ggcggatttttgggtgacctgatcaagtggaactttgagaagtttttggtggacaaaaat
ggtaaggttgtcgagagatatcagccaacaacatcacctttccagattgagaaggacatt
cagaggcttcttgcagcatga

DBGET integrated database retrieval system