KEGG   Vitis vinifera (wine grape): 100245725Help
Entry
100245725         CDS       T01084                                 

Definition
(RefSeq) replication protein A 32 kDa subunit A
  KO
K10739  replication factor A2
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi03030  DNA replication
vvi03420  Nucleotide excision repair
vvi03430  Mismatch repair
vvi03440  Homologous recombination
Module
vvi_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100245725
   03420 Nucleotide excision repair
    100245725
   03430 Mismatch repair
    100245725
   03440 Homologous recombination
    100245725
DNA replication proteins [BR:vvi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100245725
DNA repair and recombination proteins [BR:vvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100245725
   MMR (mismatch exicision repair)
     100245725
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100245725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon HTH_24 DDRGK HTH_27 B-block_TFIIIC GntR HTH_11 TrmB
Motif
Other DBs
NCBI-GeneID: 100245725
NCBI-ProteinID: XP_002282796
UniProt: D7SU26
Position
4
AA seq 268 aa AA seqDB search
MQMFSSQFDPFSGGFSSSQSTDSGVSSAKSRETQGLIPVTVKQISEASHSGDDKSNFQID
GVDVTNITLVGMVFDKSERVTDVSFALDDGTGRIECKRWVNEAFDTREMENISDGIYVRL
NGHLRSSGGNRQLVAFSVRPVTNFDEIAFHFIEVIHLHLKNSKTRLPSDALTQPLSASVK
TESTGYQTPSSQLSAQSVDGVKGLDQMVLDYLQQPSNYDREKGIHRDELSQQLKISTEKI
MESIRTLEEEGLIYSTIDEFHYKSTTSG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgttctccagccagttcgatcccttctccggtggattctcgtcatctcagtca
actgattccggcgtttcgtcggccaaaagtcgtgaaactcaaggattgatcccagtgaca
gtgaagcagatcagtgaagcttctcattccggtgatgataaatccaatttccaaatcgac
ggtgtggatgttaccaatattacattggttggaatggtgttcgataaatctgaaagggtt
actgatgtttctttcgctctcgatgatggtacaggccgaatagagtgtaaaagatgggtg
aatgaagcttttgacacaagggaaatggagaacataagtgatggaatttatgttcgtctt
aatggacacctaagaagttctggaggcaacaggcaattggttgccttttcagtgaggcct
gtgacaaattttgatgagattgccttccactttattgaggtcatacatctccatctgaag
aattccaaaacacggctgccaagtgatgccctgactcagcctttgagtgcctctgtgaag
accgaatcaactggatatcaaaccccatcaagtcagttatctgcccaaagtgttgatgga
gtcaaaggactcgaccaaatggttcttgactacctgcagcaaccttcaaactatgatcga
gaaaagggcatacacagggatgaactttcccagcagctgaaaatttctactgaaaagatc
atggaatccatcagaactcttgaagaggaagggttgatctactccacaattgatgaattt
cactacaagtcaaccacgagtggatga

DBGET integrated database retrieval system