KEGG   Vitis vinifera (wine grape): 100245725Help
Entry
100245725         CDS       T01084                                 

Definition
replication factor A protein 2-like
Orthology
K10739  
replication factor A2
Organism
vvi  Vitis vinifera (wine grape)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100245725
   03420 Nucleotide excision repair
    100245725
   03430 Mismatch repair
    100245725
   03440 Homologous recombination
    100245725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 268 aa AA seqDB search
MQMFSSQFDPFSGGFSSSQSTDSGVSSAKSRETQGLIPVTVKQISEASHSGDDKSNFQID
GVDVTNITLVGMVFDKSERVTDVSFALDDGTGRIECKRWVNEAFDTREMENISDGIYVRL
NGHLRSSGGNRQLVAFSVRPVTNFDEIAFHFIEVIHLHLKNSKTRLPSDALTQPLSASVK
TESTGYQTPSSQLSAQSVDGVKGLDQMVLDYLQQPSNYDREKGIHRDELSQQLKISTEKI
MESIRTLEEEGLIYSTIDEFHYKSTTSG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgttctccagccagttcgatcccttctccggtggattctcgtcatctcagtca
actgattccggcgtttcgtcggccaaaagtcgtgaaactcaaggattgatcccagtgaca
gtgaagcagatcagtgaagcttctcattccggtgatgataaatccaatttccaaatcgac
ggtgtggatgttaccaatattacattggttggaatggtgttcgataaatctgaaagggtt
actgatgtttctttcgctctcgatgatggtacaggccgaatagagtgtaaaagatgggtg
aatgaagcttttgacacaagggaaatggagaacataagtgatggaatttatgttcgtctt
aatggacacctaagaagttctggaggcaacaggcaattggttgccttttcagtgaggcct
gtgacaaattttgatgagattgccttccactttattgaggtcatacatctccatctgaag
aattccaaaacacggctgccaagtgatgccctgactcagcctttgagtgcctctgtgaag
accgaatcaactggatatcaaaccccatcaagtcagttatctgcccaaagtgttgatgga
gtcaaaggactcgaccaaatggttcttgactacctgcagcaaccttcaaactatgatcga
gaaaagggcatacacagggatgaactttcccagcagctgaaaatttctactgaaaagatc
atggaatccatcagaactcttgaagaggaagggttgatctactccacaattgatgaattt
cactacaagtcaaccacgagtggatga

DBGET integrated database retrieval system